Белки
<<  Белково-энергетическая недостаточность у детей раннего возраста Состав и функции белков  >>
Анализ белковой последовательности
Анализ белковой последовательности
PeptideMass
PeptideMass
PeptideMass - output
PeptideMass - output
ProtScale - output
ProtScale - output
InterPro Database
InterPro Database
InterPro Database
InterPro Database
InterPro Database
InterPro Database
SCOP-Structural Classification of Proteins
SCOP-Structural Classification of Proteins
Archetype Structures of Domains
Archetype Structures of Domains
Поиск по SCOP
Поиск по SCOP
Поиск по SCOP
Поиск по SCOP
SCOP
SCOP
CATH (Brookhaven protein databank )
CATH (Brookhaven protein databank )
CATH (Brookhaven protein databank )
CATH (Brookhaven protein databank )
DALI
DALI
DALI
DALI
DALI
DALI
DALI
DALI
DALI
DALI
DALI
DALI
Pfam Database
Pfam Database
Pfam Database
Pfam Database
Pfam Database
Pfam Database
Homstrad Database
Homstrad Database
Homstrad Database
Homstrad Database
PClass Database
PClass Database
3D Structure Validation
3D Structure Validation
Важные параметры
Важные параметры
WHAT IF
WHAT IF
Procheck
Procheck
Procheck
Procheck
Procheck
Procheck
ERRAT
ERRAT
Biotech Validation Suite
Biotech Validation Suite
Biotech Validation Suite
Biotech Validation Suite
SAV
SAV
SAV
SAV
Способы визуализации
Способы визуализации
Для чего визуализация
Для чего визуализация
Для чего визуализация
Для чего визуализация
Для чего визуализация
Для чего визуализация
Для чего визуализация
Для чего визуализация
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
RasMol
RasMol
RasMol
RasMol
RasTop
RasTop
Chime
Chime
Protein Explorer
Protein Explorer
Protein Explorer
Protein Explorer
Protein Explorer
Protein Explorer
ExPASy
ExPASy
SwissPdbViewer - Deep view
SwissPdbViewer - Deep view
SwissPdbViewer - Deep view
SwissPdbViewer - Deep view
YASARA
YASARA
YASARA
YASARA
RasMol – Главное меню
RasMol – Главное меню
RasMol – Главное меню
RasMol – Главное меню
RasMol – Главное меню
RasMol – Главное меню
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Дисплей
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol - Цвет
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol - Экспорт
RasMol - Экспорт
RasMol - Help
RasMol - Help
RasMol - Help
RasMol - Help
RasMol Manual
RasMol Manual
RasTop
RasTop
RasTop
RasTop
Swiss-PDBViewer
Swiss-PDBViewer
Swiss-PDBViewer
Swiss-PDBViewer
Картинки из презентации «Анализ белковой последовательности» к уроку биологии на тему «Белки»

Автор: hoper99. Чтобы познакомиться с картинкой полного размера, нажмите на её эскиз. Чтобы можно было использовать все картинки для урока биологии, скачайте бесплатно презентацию «Анализ белковой последовательности.ppt» со всеми картинками в zip-архиве размером 12124 КБ.

Анализ белковой последовательности

содержание презентации «Анализ белковой последовательности.ppt»
Сл Текст Сл Текст
1Анализ белковой последовательности. 48водородных связей между амидом и
Анализ только аминокислотной карбонилом Дисульфидные связи
последовательность (первичную структуру) Положительные phi торзионные углы.
белка без боковых цепей. Предсказание 49PClass Database. Инструмент для
физико-химических параметров белка классификации, базирующийся на иерархии
Предсказание продуктов расщепления 600 белков-представителей из PDB.
протеазами Гидрофобные, гидрофильные Структурное выравнивание 600 структур было
участки: например, трансмембранные выполнено при помощи алгоритма 3dSearch.
сегменты Пост-трансляционные модификации 503D Structure Validation. Теория: Белки
Функциональные домены, принадлежность к – молекулы несложные: Линейная структура
функциональным семействам Фолдинг цепей. Только 20 различных аминокислот. На
Клеточная локализация. практике: Мы не понимаем в деталях
2Анализ белковой последовательности. механизм сворачивания белковых структур.
The expasy server – протеомика Единственные «силы», используемые для
http://www.Expasy.Ch/tools/#primary the уточнения, «улучшения» новой структуры –
swiss embnet – coiled-coil участки, это данные измерений и некоторые факты,
выравнивания и др. присущие для ВСЕХ молекул В общем случае
Http://www.Ch.Embnet.Org the CBS используемая информация недостаточна для
prediction servers – локализация, распознавания уникальной структуры.
пост-трансляционные модификации… Значительная часть работы по уточнению
http://www.Cbs.Dtu.Dk/services. структуры – взгляд эксперта и ручные
3Protparam - предсказание корректировки. Белки содержат тысячи
физико-химических параметров белка. атомов и невозможно постоянно выполнять
4ProtParam. Молекулярный вес ручные корректировки. Это – источник
Аминокислотный состав Extinction неправильных структур и «слабых мест» в
coefficient – коэффициент поглощения (280 глобьально верных структурах.
nm) Instability (менее 40 – хорошо) – 51Оценка качества стереохимии. «Исходя
нестабильность в эксперименте (test tube, исключительно из координат атомов, есть ли
статистика дипептидов) Half-life (yeast in методы, дающие оценку общему
vivo, mammalian reticulocytes in vitro, стереохимическому качеству структуры?
Escherichia coli in vivo) Алифатический Такие методы могут оказаться полезными для
индекс Grand average of hydropathicity идентификации неправильно построенных
(GRAVY) гидрофильность – (-), структур во время циклов уточнения, или
гидрофобность – (+). после завершения моделирования.
5Compute pI/Mw. Большинство PDB файлов содержат некоторую
6PeptideMass. авторскую информацию о параметрах
7PeptideMass - output. кристаллографии. В то же время эта
8PeptideCutter. информация обычно короткая, количественная
9PeptideCutter - output. не готовая к machine-reading и не
10PeptideCutter - output. предоставляет качественных оценок
11Метод скользящего окна. Анализируется надёжности предоставленной структуры».
последовательность в несколько Morris et al (PROTEINS: Structure,
аминокислот, параметр усредняется по окну. Function, and Genetics 12:345-364, 1992)
Значение приписывается средней Очень полезная информация для верификации
аминокислоте. Output – график Seq. посылаемой структуры белка Introduction to
LQAPVLPSDLLSWSCVGAVGILALVSFTCV structure verification
<---*---> Window 1 <---*---> http://www.cmbi.kun.nl/gv/pdbreport/checkh
Window 2 <---*---> Window 3 Размер lp/.
окна должен соответствовать характерному 52Мы можем использовать эту PDB
размеру анализируемого свойства (для ТМ – структуру? Год публикации Разрешение X-ray
19!). Методы, основанные на технике структуры Проблемные остатки
скользящего окна, как правило, не (отсутствующие аминокислоты/атомы/боковые
интерпретируют результаты. При цепи) Растворитель/вода Какая цель?
интерпретации важно: Учитывать только 53Важные параметры. Judging the Quality
очень четко выраженные сигналы Не of Macromolecular Models
зависящие от параметров программы – http://www.cmbi.kun.nl/gv/pdbreport/checkh
размера окна, конкретного метода и т.п. lp/ R-factor: величина, показывающая
12Предсказание трансмембранных согласие между кристаллографической
сегментов: ProtScale. 56 аминокислотных моделью и полученными данными X-ray.
шкал (с литературными ссылками), Оценивая построенную модель
скользящее окно -> выбор ширины окна. кристаллографер рассчитывает ожидаемую
13ProtScale - output. интенсивность рефлексов в образце
14Более сложное предсказание дифракции и затем сравнивает его с
трансмембранных сегментов: TMHMM. экспериментальными данными, содержащими
Transmembrane beta barrel prediction: измеренные позиции и интенсивности.
PROFtmb R-factor используется для проверки
(http://rostlab.org/services/proftmb ); прогресса в уточнении структуры. Финальный
PRED-TMBB R-factor – единая мера качества модели.
(http://biophysics.biol.uoa.gr/PRED-TMBB/) Чем меньше, тем лучше. Разрешение: В X-ray
TBBPred кристаллографии "2-? model"
(http://www.imtech.res.in/raghava/tbbpred означает, что модель учитывает дифракцию в
). группе одинаковых, параллельных плоскостей
15TMHMM - результаты. TMHMM с атомами с промежутком в 2 ?. Точность
предсказывает сегменты, а также топологию атомных позиций: В кристаллографии, в
межсегментных участков. Нашёл 7 TMs. отличии от световой микроскопии, термин
16Домены. Домен – независимая «разрешение» означает количество данных, в
глобулярная единица в белке. Более конечном счете используемое для
функционально – часть белка, обладающая определения структуры. Напротив, точность
активностью (если отрезать, например). Как атомной позиции частично зависит от
правило, каждый домен играет свою роль в разрешения, но в большей степени зависит
функции белка (связывает ион или ДНК, от качества данных – R-factor. - Хорошие
содержит активный сайт и т.п.) Только данные могут приносить атомные полиции с
небольшая часть известных доменов была точностью 0.2–0.1 от заявленного
изучена экспериментально, остальные разрешения.
описаны как сходные части гомологичных 54WHAT IF. WHAT IF – CMBI (Centre for
белков Очень сложно четко определить домен Molecular and Biomolecular Informatics)
и его границы => существует много CHECK - качество структуры/модели белка
подходов и различных доменных коллекций. FULCHK – наиболее подробный отчёт о
Какую выбрать? проверке. Производимые проверки – от
17История коллекций доменов. 1980ые – простых проверок длин связей, торзионных
PROSITE: ручная выборка паттернов в углов и проверок поверхности до глубокого
белках, определяющих функцию 1987 – анализа контактов и сети водородных
доменный профайл (gribskov): position связей. Stand alone versions: Unix,
specific scoring schema – это вероятность Windows Server: WHAT_CHECK
для каждой аминокислоты находиться в http://www.cmbi.kun.nl/gv/whatcheck/ Может
данной позиции домена начало 1990х – посчитать и некоторые свойства: Атомарные
blocks, prints, prodom… pfama – коллекция дистанции, столкновения, окружения,
профайлов, курированная вручную (сейчас контакты с водой, «внутренняя» вода,
также использует HMM). водородные связи…..
18Cерверы для поиска доменов. 55WHAT_IF Validation Parameters.
InterProScan Доступность боковых цепей Длины связей –
http://www.ebi.ac.uk/InterProScan CD данные экспериментов Углы связей – данные
(Conserved Domain) server (NCBI) экспериментов Торзионные (трёхгранные)
http://www.ncbi.nlm.nih.gov/Structure/cdd/ углы, Phi/Psi (ramachandran plot) – данные
rpsb.cgi Pfscan экспериментов Планарность боковых цепей у
http://hits.isb-sib.ch/cgi-bin/PFSCAN His, Phe, Tyr – данные экспериментов
Domac Хиральность (D or L) – данные
http://www.bioinfotool.org/domac.html экспериментов Ротамеры (?-1 and ?-2
Scooby комбинации) - моделирование Столкновения
http://www.ibi.vu.nl/programs/scoobywww/ атомов – данные экспериментов Абсолютное
Dompro внутреннее/внешнее распределение
http://www.ics.uci.edu/~baldig/domain.html аминокислот Погруженные доноры водородов –
19InterPro Database. . данные экспериментов Упаковка (сравнение с
20InterPro. InterPro is a database of базами данных)
protein families, domains and functional http://www.cmbi.kun.nl/~richardn/intromode
sites in which identifiable features found Validation.html.
in known proteins can be applied to 56The PDBREPORT Database. The PDBREPORT
unknown protein sequences. Базируется на Database
первичных классификациях целого ряда баз http://www.cmbi.kun.nl/gv/pdbreport/ Index
данных функциональных доменов и семейств, of all diagnostic messages
объединяет всю доступную информацию С 2001 http://www.cmbi.kun.nl/gv/pdbreport/pdbrep
года – Release 18.0: 75.6% UniProt. rt/revindex.html.
21Как это происходит. Каждое InterPro 57WHAT_CHECK Criteria. Peptide-Pl: RMS
семейство объединяет первичные семейства distance of the backbone oxygen from the
других баз данных, описывающие один и тот oxygen in similar backbone conformations
же домен; включает все белки, found in the database, distances in the
принадлежащие хотя бы одной из первичных range [3..1] are mapped to [0..9] Rotamer:
баз. Документация семейства подробно Probability that the sidechain rotamer
описывает функцию и структуру (chi-1 only) is correct, probabilities in
соответствующей белковой подписи. the range [0.1 .. 0.9] are mapped to
22Поиск доменов: InterProScan. [0..9] Chi-1/Chi-2: Z-score for the
23Interproscan - результаты. sidechain chi-1/chi-2 combination,
24Table View. Z-scores in the range probabilities in the
25CD server. Input - accession number, range [-4..+4] are mapped to [0..9] Bumps:
gi или последовательность в FASTA формате. Sum of bumps per residue, distances in the
26CD server – output. Красный – SMART, range [0.1 .. 0] are mapped to [0..9].
синий – Pfam, зеленый – COGs Рваные концы Packing 1: First packing quality Z-score,
указывают на неполные домены!!!! Курсор в Z-scores in the range [-5..+5] are mapped
графической части – краткое описание to [0..9]. Packing 2: Second packing
функции домена. quality Z-score, Z-scores in the range
27CDART – поиск белков с аналогичной [-3..+3] are mapped to [0..9]. In/Out:
доменной структурой. Absolute inside/outside distribution
28Pfscan. Как правило, работает Z-score per residue, Z-scores in the range
несколько минут. [4..2] are mapped to [0..9]. H-Bonds: 9
29Pfscan - output. Особенности вывода minus number of unsatisfied hydrogen
Pfscan. Схема – легенда, как всегда под bonds, 2 is subtracted for buried backbone
рисунком За легендой следует таблица с nitrogen, 5 for buried sidechain. Flips:
локализацией доменов Далее расшифровка Indicates flipped Asn/Gln/His sidechain,
каждого хита – с оценкой вероятности Затем 9=OK, 0=needs flipping.
следует графическая схема для каждого хита 58WHAT_CHECK Criteria. Access: Relative
и scores (высокий score = хороший хит). side chain accessibility, 0=buried,
30Structure Classification Databases. 3D 9=exposed. Quality: Several quality
structural similarities (~70%): SCOP (MRC estimators from the PDBREPORTs.0=is oh no,
Cambridge) CATH (University College, 9=perfect. B-Factors: Crystallographic
London) Dali FSSP (EBI, Cambridge) 3 Dee B-factors, the range [10..60] is mapped to
(EBI, Cambridge) FOLD recognition: 3D-pssm [9..0] Bonds: Absolute Z-score of the
TOPITS (EMBL) UCLA-DOE Structre Prediction largest bond deviation per residue,
Server (UCLA) 123D UCSC HMM (UCSC) FAS absolute Z-Scores in the range [5..2] are
(Burnham Institute) UCLA-DOE mapped to [0..9]. Angles: Absolute Z-score
Fold-Recognition Benchmark Home Page. of the largest angle deviation per
31SCOP-Structural Classification of residue, absolute Z-Scores in the range
Proteins. База данных содержит структурную [5..2] are mapped to [0..9]. Torsions:
и эволюционную информацию о взаимосвязях Average Z-score of the torsion angles per
белков с известными структурами. residue, Z-Scores in the range [-3..+3]
Классификация белков отражает структурные are mapped to [0..9]. Phi/Psi:
и эволюционные отношения. Многоуровневая Ramachandran Z-score per residue, Z-Scores
иерархия – семейство, суперсемейство и in the range [-4..+4] are mapped to
фолд. Ручное инспектирование. [0..9]. Planarity: Z-score for the
32SCOP. Superfamily: Probable common planarity of the residue sidechain,
evolutionary origin Белки, имеющие низкую Z-Scores in the range [6..2] are mapped to
идентичность последовательностей, но чьи [0..9]. Chirality: Average absolute
структурные и функциональные особенности Z-score of the chirality deviations per
позволяют предположить наличие общего residue, average absolute Z-Scores in the
предка, могут быть объединены в range [4..2] are mapped to [0..9].
суперсемейства. Например, актин, the Backbone: Number of similar backbone
ATPase domain белков теплового шока и conformations found in the database,
гексакиназы образуют суперсемейство. Fold: numbers in the range [0..10] are mapped to
Major structural similarity Общий фолд – [0..9].
одинаковая организация вторичной 59Procheck
струкруры, с похожим пространственным http://www.biochem.ucl.ac.uk/~roman/proche
расположением и с похожими соединениями. k/procheck.html. Procheck – программа и
Белки с одинаковым фолдом зачастую имеют сервер для проверки геометрии структуры
концевые элементы вторичной структуры , белка. Геометрия ковалентных связей
изгибы и повороты различных разметов и Планарность Торзионные углы Хиральность
конформаций (до половины всей структуры). Нековалентные взаимодействия Водородные
Белки, объединённые одним фолдом, могут не связи основной цепи Дисульфидные мостики
иметь общего предка (химия, физика ? Сравнение параметров Поаминокислотный
упаковка и топология). анализ.
33SCOP. Family: Clear evolutionarily 60Procheck. Отчёты.
relationship Белки, сгруппированные в 61PDB Validation Tools. Ad it!
семейство, тесно связаны эволюционно. Это Http://pdb.Rutgers.Edu/validate/ the PDB
значит, что парное выравнивание показывает validation suite - набор инструментов,
30% и выше. Иногда похожие функция и используемый в PDB для обработки и
структура показывают наличие общего предка проверки структурных данных
и при отсутствии высокой идентичности http://pdb.Rutgers.Edu/mmcif/VAL/index.Htm
последовательностей; например, многие .
глобины образуют семейство, хотя некоторые 62ERRAT. ERRAT - алгоритм верификации
из них имеют идентичность 1D ~ 15%. белковых структур, который особенно
34Archetype Structures of Domains. подходит для оценки процесса построения и
35Поиск по SCOP. улучшения моделей в кристаллографии.
36SCOP. Программа анализирует статистики
37CATH (Brookhaven protein databank ). нековалентных взаимодействий между атомами
Class, Architecture, Topology, Homology различных типов. Общая диаграмма даёт
database – иерархическая классификация значения функции ошибки (скоринг) vs
доменов структур белков Формируется позиция 9-residue окна. Путём сравнения с
автоматически, но инспектируется вручную. статистиками из очень качественных
38CATH. Class, C-level Класс структур функция ошибки калибруется.
определяется в соответствии с набором и http://www.doe-mbi.ucla.edu/Services/Errat
упаковкой вторичной структуры. Он может html.
быть присвоен как автоматически (90% of 63PROVE. PROVE: PROtein Volume
the known structures), так и вручную. 3 Evaluation, a validation package PROVE -
главных класса: преимущественно-alpha ПО для проверки качества атомарной модели
преимущественно-beta alpha-beta макромолекулярной структуры Базируется на
(alpha/beta and alpha+beta) Четвертый расчете атомных объемов. PROVE считает
класс – белки, содержащие домены без объемы атомов в макромолекуле, используя
выраженной структуры.. алгоритм SURVOL (SURVOL обрабатывает атомы
39CATH. Architecture, A-level Описывает как твёрдые сферы с определенными
общий вид доменной структуры, определяемой радиусами, зависящими от типа атома)
как ориентация элементов вторичной Использовались высококачественные
структуры, но без учета их соединений. структуры для выяснения ожидаемых
Присваивается вручную (используя простое (средних) объемов погруженных атомов.
описание структуры). Разрабатываются Отклонения в атомных объемах оценивается в
способы автоматизации этого процесса. Z-score (how many standard deviations
Topology (fold family), T-level Структуры their volume is away from the mean for
группируются в зависимости как от общего that atom type). Ожидаемое Z-score – 0.
вида, так и от соединений элементов http://www.ucmb.ulb.ac.be/UCMB/PROVE/.
вторичной структуры. Алгоритмы сравнения 64Biotech Validation Suite. Biotech
структур. Validation Suite – EMBL
40CATH. Homologous superfamily, H-level http://biotech.ebi.ac.uk:8400/.
Этот уровень объединяет белки, которые, 65SAV. SAV- Structure Analysis and
по-видимому, имеют общего предка Verification Server
(гомологи). Похожесть и идентичнсть – http://www.doe-mbi.ucla.edu/Services/SV/
сначала по сравнению последовательностей, Information about the server – Before you
затем – сравнение структур. Sequence start
families, S-level Структуры в каждом http://www.doe-mbi.ucla.edu/Services/SV/In
H-level затем группируются по идентичности o.php.
последовательностей. Домены, объединенные 66Способы визуализации.
в семейства последовательностей, имеют 67Для чего визуализация?
идентичноcть 1D >35% , что показывает ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFI
похожие структуру и функции. LGVSLIGYAASQGPTWDPFAISINPPDLKYGLAAPLLEGGFW
41SCOP / CATH. SCOP CATH class class AITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFC
architecture fold topology homologous LQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPG
superfamily superfamily family sequence MSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQY
family domain domain CATH - RDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRG
преимущественно структурная классификация, PEWWGWWLDIPFWS.
SCOP - эволюционные взаимосвязи CATH - 68An Introduction to Protein
один класс, представляющий смешанную ?-? Architecture By A. M. Lesk.
структуру SCOP - 2 класса: ?/?: beta 69Инструменты визуализации. RasMol /
структуры параллельны, образуют ??? мотивы RasTop Chime Protein Explorer Cn3D YASARA
?+?: alpha и beta структуры присутствуют в WebLab Viewer SwissPDB Viewer VMD DINO.
различных частях протеина. 70RasMol.
42SCOP / CATH -> DALI. Structure 71RasTop.
comparison. SCOP & CATH Иерахические, 72Chime. Plugin для Netscape
базирующиеся на абстракциях Создаются Communicator и других браузеров Основное
(частично) и курируются вручную предназначение – позволяет визуализировать
экспертами. Presentation of results of the биомолекулы на компьютерах, лишённых
classification, where the methods that каких-либо других инструментов для
underlie the classification remain структурной биологии, работает как
internal. надстройка в браузере. Подобен RasMol, но
43DALI. Comparing protein structures in не поддерживает командной строки
3D. a b meander. a/b. a. b. anti parallel Дополнительная информация доступна по
b barrel. More information about DALI http://www.umass.edu/microbio/chime/chimeh
Touring protein fold space with Dali/FSSP: w/chimehow.htm Не включает дополнений и
Liisa Holm and Chris Sander. усовершенствований RasMol.
44DALI. The FSSP database (Fold 73Protein Explorer. Улучшенная версия
classification based on RasMol Графический интерфейс похож на
Structure-Structure alignment of Proteins) Chime, но с более развитой системой помощи
базируется на all-against-all сравнении 3D и автоматизации Доступен для работы
структур белков в Protein Data Bank (PDB). новичкам, нет нужды изучать команды
Классификация и выравнивание структур Обеспечивает углублённое изучение молекул
автоматически поддерживается и обновляется и их свойств для профессионалов.
сервисом Dali search engine. Dali Domain 74Protein Explorer.
Dictionary Структурные домены выделяются 75Protein Explorer.
автоматически. Каждый получает Domain 76ExPASy.
Classification number. 77SwissPdbViewer - Deep view.
45DALI. Fold types Типы фолдов – Инструмент, обладающий огромными
кластеры структур в пространстве фолдов с возможностями Позволяет анализировать
средним парным Z-scores (by Dali) выше 2. множественные структуры Позволяет изменять
Высокий Z-score соответствует структурам с углы химических связей и производить
близкой архитектурой. перенос атомов или групп атомов
46DALI. • Базируется на выравненных 2D Моделирование мутаций Моделирование с
матрицах внутримолекулярных дистанций • использованием гомологов (при подключении
Считает лучший subset соответствующих к удалённому серверу) Базовые минимизации
аминокислот в двух белках – максимальная энергии Карты электронных полей.
похожесть 2D матриц дистанций • Поиск по 78YASARA. Yet Another Scientific
всем возможным выравниваниям остатков – Artificial Application Молекулярная
Monte-Carlo и branch-and-bound algorithms. графика на очень хорошем уровне
An intra-molecular distance plot for Моделирование и симуляции (not free!).
myoglobin. 79RasMol – Главное меню.
47Pfam Database. Pfam – коллекция 80RasMol - Дисплей.
результатов множественного выравнивания 81RasMol - Цвет.
последовательностей и HMM, содержащая 82RasMol – Опции ? Сечение.
большое количество доменов и семейств 83RasMol – Опции ? Атомы H.
белков. Для каждого семейства в Pfam: 84RasMol – Опции ? Зеркальная
Просмотреть результаты MSA Увидеть поверхность.
архитектуру доменов Распределение по видам 85RasMol – Опции ? Тени.
Перекрестные ссылки Получить известные 3D 86RasMol – Опции ? Стерео.
структуры. Pfam can be accessed directly 87RasMol – Опции ? Метки.
or from the PDB description. 88RasMol - Экспорт.
48Homstrad Database. HOMologous 89RasMol - Help.
STRucture Alignment Database Предоставляет 90RasMol Manual. RasMol 2.6 Manual
выровненные 3D структуры гомологичных http://www.umass.edu/microbio/rasmol/getra
белков. Homstrad - структурный эквивалент .htm#rasmanual RasMol 2.7 Manual
Pfam. Вначале структуры белков поступают http://www.rasmol.org/.
из PDB, кандидаты семейств традиционно 91RasTop. Download RasTop and install
идентифицируются поиском по Pfam. it. Repeat RasMol assignment 2 with
Используются определения доменов из SCOP и RasTop.
информация о белках собирается из 92Swiss-PDBViewer. Домашняя страница:
SwissProt, Pfam and Interpro. http://ca.expasy.org/spdbv/ Руководство
Аннотирование – в программе Joy, которая пользователя
предоставляет следующую информацию: Тип http://ca.expasy.org/spdbv/text/tutorial.h
вторичной структуры Относительную m.
доступность боковых цепей Наличие 93Swiss-PDBViewer.
Анализ белковой последовательности.ppt
http://900igr.net/kartinka/biologija/analiz-belkovoj-posledovatelnosti-169583.html
cсылка на страницу

Анализ белковой последовательности

другие презентации на тему «Анализ белковой последовательности»

«Предел числовой последовательности» - Функцию y = f(x) называют непрерывной в точке x = a, если выполняется условие. Заданием аналитической формулы. Величина уn называется общим членом последовательности. Пример: 1, 3, 5, 7, 9, 2п-1, … - возрастающая последовательность. Свойства пределов. Возрастающие и убывающие последовательности называют монотонными.

«Числовые последовательности» - Способы задания. Урок-конференция. «Числовые последовательности». Геометрическая прогрессия. Арифметическая прогрессия. Числовые последовательности.

«Строение белков» - Способ свертывания полипептидных цепей глобулярных белков называется третичной структурой. Структура белка – вторичная структура. Проверка домашнего задания. Определяется ионами (фосфатная буферная система, бикарбонатная буферная система). Выполняют строительную функцию. Структура белков – первичная структура.

«Предел последовательности» - Предел суммы равен сумме пределов: 4. Число b называют пределом последовательности , если: Вычисление пределов последовательности. Дорогой друг, теперь тебе предстоит проверить свои знания. Свойство 1. Если последовательность сходится, то только к одному пределу. Определение 1. Пусть а – точка прямой, а r – положительное число.

«Последовательность» - Что есть последовательность? Последовательности могут быть конечными и бесконечными, возрастающими и убывающими. «Последовательности». Обозначают члены последовательности так а1; а2; а3; а4; … аn; Мы получили не что иное, как числа Фибоначчи. Последовательности составляют такие элементы природы, которые можно как то пронумеровать.

«Последовательность чисел» - Чередовать увеличение на 2 и увеличение в 2 раза. Увеличение на 3 раза. В порядке убывания правильные дроби с числителем, равным 1. Номер счёта в банке. Дома на улице. Между числами Фибоначчи и треугольником Паскаля существует связь. Числовые последовательности. Урок по алгебре в 9 классе. Способы задания последовательностей.

Белки

11 презентаций о белках
Урок

Биология

136 тем
Картинки
900igr.net > Презентации по биологии > Белки > Анализ белковой последовательности