Белки
<<  Белково-энергетическая недостаточность у детей раннего возраста Состав и функции белков  >>
Анализ белковой последовательности
Анализ белковой последовательности
Анализ белковой последовательности
Анализ белковой последовательности
Protparam - предсказание физико-химических параметров белка
Protparam - предсказание физико-химических параметров белка
ProtParam
ProtParam
Compute pI/Mw
Compute pI/Mw
PeptideMass
PeptideMass
PeptideMass - output
PeptideMass - output
PeptideCutter
PeptideCutter
PeptideCutter - output
PeptideCutter - output
PeptideCutter - output
PeptideCutter - output
Метод скользящего окна
Метод скользящего окна
Предсказание трансмембранных сегментов: ProtScale
Предсказание трансмембранных сегментов: ProtScale
ProtScale - output
ProtScale - output
Более сложное предсказание трансмембранных сегментов: TMHMM
Более сложное предсказание трансмембранных сегментов: TMHMM
TMHMM - результаты
TMHMM - результаты
Домены
Домены
История коллекций доменов
История коллекций доменов
Cерверы для поиска доменов
Cерверы для поиска доменов
InterPro Database
InterPro Database
InterPro
InterPro
Как это происходит
Как это происходит
Поиск доменов: InterProScan
Поиск доменов: InterProScan
Interproscan - результаты
Interproscan - результаты
Table View
Table View
CD server
CD server
CD server – output
CD server – output
CDART – поиск белков с аналогичной доменной структурой
CDART – поиск белков с аналогичной доменной структурой
Pfscan
Pfscan
Pfscan - output
Pfscan - output
Structure Classification Databases
Structure Classification Databases
SCOP-Structural Classification of Proteins
SCOP-Structural Classification of Proteins
SCOP
SCOP
SCOP
SCOP
Archetype Structures of Domains
Archetype Structures of Domains
Поиск по SCOP
Поиск по SCOP
SCOP
SCOP
CATH (Brookhaven protein databank )
CATH (Brookhaven protein databank )
CATH
CATH
CATH
CATH
CATH
CATH
SCOP / CATH
SCOP / CATH
SCOP / CATH -> DALI
SCOP / CATH -> DALI
DALI
DALI
DALI
DALI
DALI
DALI
DALI
DALI
Pfam Database
Pfam Database
Homstrad Database
Homstrad Database
PClass Database
PClass Database
3D Structure Validation
3D Structure Validation
Оценка качества стереохимии
Оценка качества стереохимии
Мы можем использовать эту PDB структуру
Мы можем использовать эту PDB структуру
Важные параметры
Важные параметры
WHAT IF
WHAT IF
WHAT_IF Validation Parameters
WHAT_IF Validation Parameters
The PDBREPORT Database
The PDBREPORT Database
WHAT_CHECK Criteria
WHAT_CHECK Criteria
WHAT_CHECK Criteria
WHAT_CHECK Criteria
Procheck http://www
Procheck http://www
Procheck
Procheck
PDB Validation Tools
PDB Validation Tools
ERRAT
ERRAT
PROVE
PROVE
Biotech Validation Suite
Biotech Validation Suite
SAV
SAV
Способы визуализации
Способы визуализации
Для чего визуализация
Для чего визуализация
An Introduction to Protein Architecture By A. M. Lesk
An Introduction to Protein Architecture By A. M. Lesk
Инструменты визуализации
Инструменты визуализации
RasMol
RasMol
RasTop
RasTop
Chime
Chime
Protein Explorer
Protein Explorer
Protein Explorer
Protein Explorer
Protein Explorer
Protein Explorer
ExPASy
ExPASy
SwissPdbViewer - Deep view
SwissPdbViewer - Deep view
YASARA
YASARA
RasMol – Главное меню
RasMol – Главное меню
RasMol - Дисплей
RasMol - Дисплей
RasMol - Цвет
RasMol - Цвет
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol – Опции
RasMol - Экспорт
RasMol - Экспорт
RasMol - Help
RasMol - Help
RasMol Manual
RasMol Manual
RasTop
RasTop
Swiss-PDBViewer
Swiss-PDBViewer
Swiss-PDBViewer
Swiss-PDBViewer

Презентация: «Анализ белковой последовательности». Автор: hoper99. Файл: «Анализ белковой последовательности.ppt». Размер zip-архива: 12124 КБ.

Анализ белковой последовательности

содержание презентации «Анализ белковой последовательности.ppt»
СлайдТекст
1 Анализ белковой последовательности

Анализ белковой последовательности

Анализ только аминокислотной последовательность (первичную структуру) белка без боковых цепей. Предсказание физико-химических параметров белка Предсказание продуктов расщепления протеазами Гидрофобные, гидрофильные участки: например, трансмембранные сегменты Пост-трансляционные модификации Функциональные домены, принадлежность к функциональным семействам Фолдинг Клеточная локализация

2 Анализ белковой последовательности

Анализ белковой последовательности

The expasy server – протеомика http://www.Expasy.Ch/tools/#primary the swiss embnet – coiled-coil участки, выравнивания и др. Http://www.Ch.Embnet.Org the CBS prediction servers – локализация, пост-трансляционные модификации… http://www.Cbs.Dtu.Dk/services

3 Protparam - предсказание физико-химических параметров белка

Protparam - предсказание физико-химических параметров белка

4 ProtParam

ProtParam

Молекулярный вес Аминокислотный состав Extinction coefficient – коэффициент поглощения (280 nm) Instability (менее 40 – хорошо) – нестабильность в эксперименте (test tube, статистика дипептидов) Half-life (yeast in vivo, mammalian reticulocytes in vitro, Escherichia coli in vivo) Алифатический индекс Grand average of hydropathicity (GRAVY) гидрофильность – (-), гидрофобность – (+)

5 Compute pI/Mw

Compute pI/Mw

6 PeptideMass

PeptideMass

7 PeptideMass - output

PeptideMass - output

8 PeptideCutter

PeptideCutter

9 PeptideCutter - output

PeptideCutter - output

10 PeptideCutter - output

PeptideCutter - output

11 Метод скользящего окна

Метод скользящего окна

Анализируется последовательность в несколько аминокислот, параметр усредняется по окну. Значение приписывается средней аминокислоте. Output – график Seq. LQAPVLPSDLLSWSCVGAVGILALVSFTCV <---*---> Window 1 <---*---> Window 2 <---*---> Window 3 Размер окна должен соответствовать характерному размеру анализируемого свойства (для ТМ – 19!)

Методы, основанные на технике скользящего окна, как правило, не интерпретируют результаты. При интерпретации важно: Учитывать только очень четко выраженные сигналы Не зависящие от параметров программы – размера окна, конкретного метода и т.п.

12 Предсказание трансмембранных сегментов: ProtScale

Предсказание трансмембранных сегментов: ProtScale

56 аминокислотных шкал (с литературными ссылками), скользящее окно -> выбор ширины окна

13 ProtScale - output

ProtScale - output

14 Более сложное предсказание трансмембранных сегментов: TMHMM

Более сложное предсказание трансмембранных сегментов: TMHMM

Transmembrane beta barrel prediction: PROFtmb (http://rostlab.org/services/proftmb ); PRED-TMBB (http://biophysics.biol.uoa.gr/PRED-TMBB/); TBBPred (http://www.imtech.res.in/raghava/tbbpred )

15 TMHMM - результаты

TMHMM - результаты

TMHMM предсказывает сегменты, а также топологию межсегментных участков

Нашёл 7 TMs

16 Домены

Домены

Домен – независимая глобулярная единица в белке. Более функционально – часть белка, обладающая активностью (если отрезать, например). Как правило, каждый домен играет свою роль в функции белка (связывает ион или ДНК, содержит активный сайт и т.п.) Только небольшая часть известных доменов была изучена экспериментально, остальные описаны как сходные части гомологичных белков Очень сложно четко определить домен и его границы => существует много подходов и различных доменных коллекций. Какую выбрать?

17 История коллекций доменов

История коллекций доменов

1980ые – PROSITE: ручная выборка паттернов в белках, определяющих функцию 1987 – доменный профайл (gribskov): position specific scoring schema – это вероятность для каждой аминокислоты находиться в данной позиции домена начало 1990х – blocks, prints, prodom… pfama – коллекция профайлов, курированная вручную (сейчас также использует HMM)

18 Cерверы для поиска доменов

Cерверы для поиска доменов

InterProScan http://www.ebi.ac.uk/InterProScan CD (Conserved Domain) server (NCBI) http://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi Pfscan http://hits.isb-sib.ch/cgi-bin/PFSCAN Domac http://www.bioinfotool.org/domac.html Scooby http://www.ibi.vu.nl/programs/scoobywww/ Dompro http://www.ics.uci.edu/~baldig/domain.html

19 InterPro Database

InterPro Database

.

20 InterPro

InterPro

InterPro is a database of protein families, domains and functional sites in which identifiable features found in known proteins can be applied to unknown protein sequences. Базируется на первичных классификациях целого ряда баз данных функциональных доменов и семейств, объединяет всю доступную информацию С 2001 года – Release 18.0: 75.6% UniProt

21 Как это происходит

Как это происходит

Каждое InterPro семейство объединяет первичные семейства других баз данных, описывающие один и тот же домен; включает все белки, принадлежащие хотя бы одной из первичных баз. Документация семейства подробно описывает функцию и структуру соответствующей белковой подписи.

22 Поиск доменов: InterProScan

Поиск доменов: InterProScan

23 Interproscan - результаты

Interproscan - результаты

24 Table View

Table View

25 CD server

CD server

Input - accession number, gi или последовательность в FASTA формате

26 CD server – output

CD server – output

Красный – SMART, синий – Pfam, зеленый – COGs Рваные концы указывают на неполные домены!!!! Курсор в графической части – краткое описание функции домена

27 CDART – поиск белков с аналогичной доменной структурой

CDART – поиск белков с аналогичной доменной структурой

28 Pfscan

Pfscan

Как правило, работает несколько минут

29 Pfscan - output

Pfscan - output

Особенности вывода Pfscan

Схема – легенда, как всегда под рисунком За легендой следует таблица с локализацией доменов Далее расшифровка каждого хита – с оценкой вероятности Затем следует графическая схема для каждого хита и scores (высокий score = хороший хит)

30 Structure Classification Databases

Structure Classification Databases

3D structural similarities (~70%): SCOP (MRC Cambridge) CATH (University College, London) Dali FSSP (EBI, Cambridge) 3 Dee (EBI, Cambridge) FOLD recognition: 3D-pssm TOPITS (EMBL) UCLA-DOE Structre Prediction Server (UCLA) 123D UCSC HMM (UCSC) FAS (Burnham Institute) UCLA-DOE Fold-Recognition Benchmark Home Page

31 SCOP-Structural Classification of Proteins

SCOP-Structural Classification of Proteins

База данных содержит структурную и эволюционную информацию о взаимосвязях белков с известными структурами. Классификация белков отражает структурные и эволюционные отношения. Многоуровневая иерархия – семейство, суперсемейство и фолд. Ручное инспектирование.

32 SCOP

SCOP

Superfamily: Probable common evolutionary origin Белки, имеющие низкую идентичность последовательностей, но чьи структурные и функциональные особенности позволяют предположить наличие общего предка, могут быть объединены в суперсемейства. Например, актин, the ATPase domain белков теплового шока и гексакиназы образуют суперсемейство

Fold: Major structural similarity Общий фолд – одинаковая организация вторичной струкруры, с похожим пространственным расположением и с похожими соединениями. Белки с одинаковым фолдом зачастую имеют концевые элементы вторичной структуры , изгибы и повороты различных разметов и конформаций (до половины всей структуры). Белки, объединённые одним фолдом, могут не иметь общего предка (химия, физика ? упаковка и топология)

33 SCOP

SCOP

Family: Clear evolutionarily relationship Белки, сгруппированные в семейство, тесно связаны эволюционно. Это значит, что парное выравнивание показывает 30% и выше. Иногда похожие функция и структура показывают наличие общего предка и при отсутствии высокой идентичности последовательностей; например, многие глобины образуют семейство, хотя некоторые из них имеют идентичность 1D ~ 15%.

34 Archetype Structures of Domains

Archetype Structures of Domains

35 Поиск по SCOP

Поиск по SCOP

36 SCOP

SCOP

37 CATH (Brookhaven protein databank )

CATH (Brookhaven protein databank )

Class, Architecture, Topology, Homology database – иерархическая классификация доменов структур белков Формируется автоматически, но инспектируется вручную

38 CATH

CATH

Class, C-level Класс определяется в соответствии с набором и упаковкой вторичной структуры. Он может быть присвоен как автоматически (90% of the known structures), так и вручную. 3 главных класса: преимущественно-alpha преимущественно-beta alpha-beta (alpha/beta and alpha+beta) Четвертый класс – белки, содержащие домены без выраженной структуры..

39 CATH

CATH

Architecture, A-level Описывает общий вид доменной структуры, определяемой как ориентация элементов вторичной структуры, но без учета их соединений. Присваивается вручную (используя простое описание структуры). Разрабатываются способы автоматизации этого процесса. Topology (fold family), T-level Структуры группируются в зависимости как от общего вида, так и от соединений элементов вторичной структуры. Алгоритмы сравнения структур.

40 CATH

CATH

Homologous superfamily, H-level Этот уровень объединяет белки, которые, по-видимому, имеют общего предка (гомологи). Похожесть и идентичнсть – сначала по сравнению последовательностей, затем – сравнение структур. Sequence families, S-level Структуры в каждом H-level затем группируются по идентичности последовательностей. Домены, объединенные в семейства последовательностей, имеют идентичноcть 1D >35% , что показывает похожие структуру и функции.

41 SCOP / CATH

SCOP / CATH

SCOP CATH class class architecture fold topology homologous superfamily superfamily family sequence family domain domain CATH - преимущественно структурная классификация, SCOP - эволюционные взаимосвязи CATH - один класс, представляющий смешанную ?-? структуру SCOP - 2 класса: ?/?: beta структуры параллельны, образуют ??? мотивы ?+?: alpha и beta структуры присутствуют в различных частях протеина

42 SCOP / CATH -> DALI

SCOP / CATH -> DALI

Structure comparison

SCOP & CATH Иерахические, базирующиеся на абстракциях Создаются (частично) и курируются вручную экспертами

Presentation of results of the classification, where the methods that underlie the classification remain internal

43 DALI

DALI

Comparing protein structures in 3D

a b meander

a/b

a

b

anti parallel b barrel

More information about DALI Touring protein fold space with Dali/FSSP: Liisa Holm and Chris Sander

44 DALI

DALI

The FSSP database (Fold classification based on Structure-Structure alignment of Proteins) базируется на all-against-all сравнении 3D структур белков в Protein Data Bank (PDB). Классификация и выравнивание структур автоматически поддерживается и обновляется сервисом Dali search engine. Dali Domain Dictionary Структурные домены выделяются автоматически. Каждый получает Domain Classification number.

45 DALI

DALI

Fold types Типы фолдов – кластеры структур в пространстве фолдов с средним парным Z-scores (by Dali) выше 2. Высокий Z-score соответствует структурам с близкой архитектурой.

46 DALI

DALI

• Базируется на выравненных 2D матрицах внутримолекулярных дистанций • Считает лучший subset соответствующих аминокислот в двух белках – максимальная похожесть 2D матриц дистанций • Поиск по всем возможным выравниваниям остатков – Monte-Carlo и branch-and-bound algorithms

An intra-molecular distance plot for myoglobin

47 Pfam Database

Pfam Database

Pfam – коллекция результатов множественного выравнивания последовательностей и HMM, содержащая большое количество доменов и семейств белков. Для каждого семейства в Pfam: Просмотреть результаты MSA Увидеть архитектуру доменов Распределение по видам Перекрестные ссылки Получить известные 3D структуры

Pfam can be accessed directly or from the PDB description.

48 Homstrad Database

Homstrad Database

HOMologous STRucture Alignment Database Предоставляет выровненные 3D структуры гомологичных белков. Homstrad - структурный эквивалент Pfam. Вначале структуры белков поступают из PDB, кандидаты семейств традиционно идентифицируются поиском по Pfam. Используются определения доменов из SCOP и информация о белках собирается из SwissProt, Pfam and Interpro. Аннотирование – в программе Joy, которая предоставляет следующую информацию: Тип вторичной структуры Относительную доступность боковых цепей Наличие водородных связей между амидом и карбонилом Дисульфидные связи Положительные phi торзионные углы

49 PClass Database

PClass Database

Инструмент для классификации, базирующийся на иерархии 600 белков-представителей из PDB. Структурное выравнивание 600 структур было выполнено при помощи алгоритма 3dSearch.

50 3D Structure Validation

3D Structure Validation

Теория: Белки – молекулы несложные: Линейная структура цепей. Только 20 различных аминокислот. На практике: Мы не понимаем в деталях механизм сворачивания белковых структур. Единственные «силы», используемые для уточнения, «улучшения» новой структуры – это данные измерений и некоторые факты, присущие для ВСЕХ молекул В общем случае используемая информация недостаточна для распознавания уникальной структуры. Значительная часть работы по уточнению структуры – взгляд эксперта и ручные корректировки. Белки содержат тысячи атомов и невозможно постоянно выполнять ручные корректировки. Это – источник неправильных структур и «слабых мест» в глобьально верных структурах.

51 Оценка качества стереохимии

Оценка качества стереохимии

«Исходя исключительно из координат атомов, есть ли методы, дающие оценку общему стереохимическому качеству структуры? Такие методы могут оказаться полезными для идентификации неправильно построенных структур во время циклов уточнения, или после завершения моделирования. Большинство PDB файлов содержат некоторую авторскую информацию о параметрах кристаллографии. В то же время эта информация обычно короткая, количественная не готовая к machine-reading и не предоставляет качественных оценок надёжности предоставленной структуры». Morris et al (PROTEINS: Structure, Function, and Genetics 12:345-364, 1992) Очень полезная информация для верификации посылаемой структуры белка Introduction to structure verification http://www.cmbi.kun.nl/gv/pdbreport/checkhelp/

52 Мы можем использовать эту PDB структуру

Мы можем использовать эту PDB структуру

Год публикации Разрешение X-ray структуры Проблемные остатки (отсутствующие аминокислоты/атомы/боковые цепи) Растворитель/вода Какая цель?

53 Важные параметры

Важные параметры

Judging the Quality of Macromolecular Models http://www.cmbi.kun.nl/gv/pdbreport/checkhelp/ R-factor: величина, показывающая согласие между кристаллографической моделью и полученными данными X-ray. Оценивая построенную модель кристаллографер рассчитывает ожидаемую интенсивность рефлексов в образце дифракции и затем сравнивает его с экспериментальными данными, содержащими измеренные позиции и интенсивности. R-factor используется для проверки прогресса в уточнении структуры. Финальный R-factor – единая мера качества модели. Чем меньше, тем лучше. Разрешение: В X-ray кристаллографии "2-? model" означает, что модель учитывает дифракцию в группе одинаковых, параллельных плоскостей с атомами с промежутком в 2 ?. Точность атомных позиций: В кристаллографии, в отличии от световой микроскопии, термин «разрешение» означает количество данных, в конечном счете используемое для определения структуры. Напротив, точность атомной позиции частично зависит от разрешения, но в большей степени зависит от качества данных – R-factor. - Хорошие данные могут приносить атомные полиции с точностью 0.2–0.1 от заявленного разрешения.

54 WHAT IF

WHAT IF

WHAT IF – CMBI (Centre for Molecular and Biomolecular Informatics) CHECK - качество структуры/модели белка FULCHK – наиболее подробный отчёт о проверке. Производимые проверки – от простых проверок длин связей, торзионных углов и проверок поверхности до глубокого анализа контактов и сети водородных связей. Stand alone versions: Unix, Windows Server: WHAT_CHECK http://www.cmbi.kun.nl/gv/whatcheck/ Может посчитать и некоторые свойства: Атомарные дистанции, столкновения, окружения, контакты с водой, «внутренняя» вода, водородные связи…..

55 WHAT_IF Validation Parameters

WHAT_IF Validation Parameters

Доступность боковых цепей Длины связей – данные экспериментов Углы связей – данные экспериментов Торзионные (трёхгранные) углы, Phi/Psi (ramachandran plot) – данные экспериментов Планарность боковых цепей у His, Phe, Tyr – данные экспериментов Хиральность (D or L) – данные экспериментов Ротамеры (?-1 and ?-2 комбинации) - моделирование Столкновения атомов – данные экспериментов Абсолютное внутреннее/внешнее распределение аминокислот Погруженные доноры водородов – данные экспериментов Упаковка (сравнение с базами данных) http://www.cmbi.kun.nl/~richardn/intromodelValidation.html

56 The PDBREPORT Database

The PDBREPORT Database

The PDBREPORT Database http://www.cmbi.kun.nl/gv/pdbreport/ Index of all diagnostic messages http://www.cmbi.kun.nl/gv/pdbreport/pdbreport/revindex.html

57 WHAT_CHECK Criteria

WHAT_CHECK Criteria

Peptide-Pl: RMS distance of the backbone oxygen from the oxygen in similar backbone conformations found in the database, distances in the range [3..1] are mapped to [0..9] Rotamer: Probability that the sidechain rotamer (chi-1 only) is correct, probabilities in the range [0.1 .. 0.9] are mapped to [0..9] Chi-1/Chi-2: Z-score for the sidechain chi-1/chi-2 combination, Z-scores in the range probabilities in the range [-4..+4] are mapped to [0..9] Bumps: Sum of bumps per residue, distances in the range [0.1 .. 0] are mapped to [0..9]. Packing 1: First packing quality Z-score, Z-scores in the range [-5..+5] are mapped to [0..9]. Packing 2: Second packing quality Z-score, Z-scores in the range [-3..+3] are mapped to [0..9]. In/Out: Absolute inside/outside distribution Z-score per residue, Z-scores in the range [4..2] are mapped to [0..9]. H-Bonds: 9 minus number of unsatisfied hydrogen bonds, 2 is subtracted for buried backbone nitrogen, 5 for buried sidechain. Flips: Indicates flipped Asn/Gln/His sidechain, 9=OK, 0=needs flipping.

58 WHAT_CHECK Criteria

WHAT_CHECK Criteria

Access: Relative side chain accessibility, 0=buried, 9=exposed. Quality: Several quality estimators from the PDBREPORTs.0=is oh no, 9=perfect. B-Factors: Crystallographic B-factors, the range [10..60] is mapped to [9..0] Bonds: Absolute Z-score of the largest bond deviation per residue, absolute Z-Scores in the range [5..2] are mapped to [0..9]. Angles: Absolute Z-score of the largest angle deviation per residue, absolute Z-Scores in the range [5..2] are mapped to [0..9]. Torsions: Average Z-score of the torsion angles per residue, Z-Scores in the range [-3..+3] are mapped to [0..9]. Phi/Psi: Ramachandran Z-score per residue, Z-Scores in the range [-4..+4] are mapped to [0..9]. Planarity: Z-score for the planarity of the residue sidechain, Z-Scores in the range [6..2] are mapped to [0..9]. Chirality: Average absolute Z-score of the chirality deviations per residue, average absolute Z-Scores in the range [4..2] are mapped to [0..9]. Backbone: Number of similar backbone conformations found in the database, numbers in the range [0..10] are mapped to [0..9]

59 Procheck http://www

Procheck http://www

biochem.ucl.ac.uk/~roman/procheck/procheck.html

Procheck – программа и сервер для проверки геометрии структуры белка. Геометрия ковалентных связей Планарность Торзионные углы Хиральность Нековалентные взаимодействия Водородные связи основной цепи Дисульфидные мостики Сравнение параметров Поаминокислотный анализ

60 Procheck

Procheck

Отчёты

61 PDB Validation Tools

PDB Validation Tools

Ad it! Http://pdb.Rutgers.Edu/validate/ the PDB validation suite - набор инструментов, используемый в PDB для обработки и проверки структурных данных http://pdb.Rutgers.Edu/mmcif/VAL/index.Html

62 ERRAT

ERRAT

ERRAT - алгоритм верификации белковых структур, который особенно подходит для оценки процесса построения и улучшения моделей в кристаллографии. Программа анализирует статистики нековалентных взаимодействий между атомами различных типов. Общая диаграмма даёт значения функции ошибки (скоринг) vs позиция 9-residue окна. Путём сравнения с статистиками из очень качественных структур функция ошибки калибруется. http://www.doe-mbi.ucla.edu/Services/Errat.html

63 PROVE

PROVE

PROVE: PROtein Volume Evaluation, a validation package PROVE - ПО для проверки качества атомарной модели макромолекулярной структуры Базируется на расчете атомных объемов. PROVE считает объемы атомов в макромолекуле, используя алгоритм SURVOL (SURVOL обрабатывает атомы как твёрдые сферы с определенными радиусами, зависящими от типа атома) Использовались высококачественные структуры для выяснения ожидаемых (средних) объемов погруженных атомов. Отклонения в атомных объемах оценивается в Z-score (how many standard deviations their volume is away from the mean for that atom type). Ожидаемое Z-score – 0. http://www.ucmb.ulb.ac.be/UCMB/PROVE/

64 Biotech Validation Suite

Biotech Validation Suite

Biotech Validation Suite – EMBL http://biotech.ebi.ac.uk:8400/

65 SAV

SAV

SAV- Structure Analysis and Verification Server http://www.doe-mbi.ucla.edu/Services/SV/ Information about the server – Before you start http://www.doe-mbi.ucla.edu/Services/SV/Info.php

66 Способы визуализации

Способы визуализации

67 Для чего визуализация

Для чего визуализация

ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS

68 An Introduction to Protein Architecture By A. M. Lesk

An Introduction to Protein Architecture By A. M. Lesk

69 Инструменты визуализации

Инструменты визуализации

RasMol / RasTop Chime Protein Explorer Cn3D YASARA WebLab Viewer SwissPDB Viewer VMD DINO

70 RasMol

RasMol

71 RasTop

RasTop

72 Chime

Chime

Plugin для Netscape Communicator и других браузеров Основное предназначение – позволяет визуализировать биомолекулы на компьютерах, лишённых каких-либо других инструментов для структурной биологии, работает как надстройка в браузере. Подобен RasMol, но не поддерживает командной строки Дополнительная информация доступна по http://www.umass.edu/microbio/chime/chimehow/chimehow.htm Не включает дополнений и усовершенствований RasMol

73 Protein Explorer

Protein Explorer

Улучшенная версия RasMol Графический интерфейс похож на Chime, но с более развитой системой помощи и автоматизации Доступен для работы новичкам, нет нужды изучать команды Обеспечивает углублённое изучение молекул и их свойств для профессионалов

74 Protein Explorer

Protein Explorer

75 Protein Explorer

Protein Explorer

76 ExPASy

ExPASy

77 SwissPdbViewer - Deep view

SwissPdbViewer - Deep view

Инструмент, обладающий огромными возможностями Позволяет анализировать множественные структуры Позволяет изменять углы химических связей и производить перенос атомов или групп атомов Моделирование мутаций Моделирование с использованием гомологов (при подключении к удалённому серверу) Базовые минимизации энергии Карты электронных полей

78 YASARA

YASARA

Yet Another Scientific Artificial Application Молекулярная графика на очень хорошем уровне Моделирование и симуляции (not free!)

79 RasMol – Главное меню

RasMol – Главное меню

80 RasMol - Дисплей

RasMol - Дисплей

81 RasMol - Цвет

RasMol - Цвет

82 RasMol – Опции

RasMol – Опции

Сечение

83 RasMol – Опции

RasMol – Опции

Атомы H

84 RasMol – Опции

RasMol – Опции

Зеркальная поверхность

85 RasMol – Опции

RasMol – Опции

Тени

86 RasMol – Опции

RasMol – Опции

Стерео

87 RasMol – Опции

RasMol – Опции

Метки

88 RasMol - Экспорт

RasMol - Экспорт

89 RasMol - Help

RasMol - Help

90 RasMol Manual

RasMol Manual

RasMol 2.6 Manual http://www.umass.edu/microbio/rasmol/getras.htm#rasmanual RasMol 2.7 Manual http://www.rasmol.org/

91 RasTop

RasTop

Download RasTop and install it. Repeat RasMol assignment 2 with RasTop.

92 Swiss-PDBViewer

Swiss-PDBViewer

Домашняя страница: http://ca.expasy.org/spdbv/ Руководство пользователя http://ca.expasy.org/spdbv/text/tutorial.htm.

93 Swiss-PDBViewer

Swiss-PDBViewer

«Анализ белковой последовательности»
http://900igr.net/prezentacija/biologija/analiz-belkovoj-posledovatelnosti-169583.html
cсылка на страницу
Урок

Биология

136 тем
Слайды
900igr.net > Презентации по биологии > Белки > Анализ белковой последовательности