Генная инженерия
<<  Биотехнология Биотехнология  >>
Биотехнология
Биотехнология
Фракционирование продуктов биосинтеза
Фракционирование продуктов биосинтеза
3
3
Специфичность технологических стадий
Специфичность технологических стадий
Специфичность технологических стадий
Специфичность технологических стадий
Специфичность технологических стадий
Специфичность технологических стадий
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Максимально достижимые плотности растворов градиентообразующих веществ
Максимально достижимые плотности растворов градиентообразующих веществ
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Этапы фракционирования
Разделение суспензий фильтрованием
Разделение суспензий фильтрованием
Разделение суспензий фильтрованием
Разделение суспензий фильтрованием
Разделение суспензий фильтрованием
Разделение суспензий фильтрованием
Разделение суспензий фильтрованием
Разделение суспензий фильтрованием
Общие принципы фракционирования экстрактов биологического сырья
Общие принципы фракционирования экстрактов биологического сырья
Общие принципы фракционирования экстрактов биологического сырья
Общие принципы фракционирования экстрактов биологического сырья
Дезинтеграция
Дезинтеграция
Механическая дезинтеграция
Механическая дезинтеграция
Механическая дезинтеграция
Механическая дезинтеграция
Механическая дезинтеграция
Механическая дезинтеграция
Механическая дезинтеграция
Механическая дезинтеграция
Ультразвуковая дезинтеграция
Ультразвуковая дезинтеграция
Ультразвуковая дезинтеграция
Ультразвуковая дезинтеграция
Химическая дезинтеграция
Химическая дезинтеграция
Химическая дезинтеграция
Химическая дезинтеграция
Химическая дезинтеграция
Химическая дезинтеграция
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Фракционирование клеточных экстрактов
Аффинное осаждение
Аффинное осаждение
Аффинное осаждение
Аффинное осаждение
Распределительные методы
Распределительные методы
Распределительные методы
Распределительные методы
Распределительные методы
Распределительные методы
Распределительные методы
Распределительные методы
Распределительные методы
Распределительные методы
Распределительные методы
Распределительные методы
Распределение в системах с несмешивающимися водными растворами
Распределение в системах с несмешивающимися водными растворами
Системы с несмешивающимися водными растворами полимеров
Системы с несмешивающимися водными растворами полимеров
Системы с несмешивающимися водными растворами полимеров
Системы с несмешивающимися водными растворами полимеров
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Водные двухфазные системы
Аффинные методы в двуфазном распределении
Аффинные методы в двуфазном распределении
Аффинные методы в двуфазном распределении
Аффинные методы в двуфазном распределении
Хроматографические методы
Хроматографические методы
Хроматографические методы
Хроматографические методы
Хроматографические методы
Хроматографические методы
Хроматографические методы
Хроматографические методы
Хроматографические методы
Хроматографические методы
Хроматографические методы
Хроматографические методы
Ионообменная хроматография
Ионообменная хроматография
Ионообменная хроматография
Ионообменная хроматография
Ионообменная хроматография
Ионообменная хроматография
Ионообменная хроматография
Ионообменная хроматография
Ионообменная хроматография
Ионообменная хроматография
Гель-фильтрация
Гель-фильтрация
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Аффинная хроматография
Матрицы и условия элюции для различных аффинных фрагментов
Матрицы и условия элюции для различных аффинных фрагментов
Матрицы и условия элюции для различных аффинных фрагментов
Матрицы и условия элюции для различных аффинных фрагментов
Интеиновые конструкции
Интеиновые конструкции
Интеиновые конструкции
Интеиновые конструкции
Интеиновые конструкции
Интеиновые конструкции
Интеиновые конструкции
Интеиновые конструкции
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Аппаратурное оформление хроматографических процессов
Препаративные хроматографические колонны
Препаративные хроматографические колонны
Препаративные хроматографические колонны
Препаративные хроматографические колонны
Хроматография с симуляцией подвижного слоя сорбента
Хроматография с симуляцией подвижного слоя сорбента
Хроматография с симуляцией подвижного слоя сорбента
Хроматография с симуляцией подвижного слоя сорбента
Хроматография с симуляцией подвижного слоя сорбента
Хроматография с симуляцией подвижного слоя сорбента
Хроматография с симуляцией подвижного слоя сорбента
Хроматография с симуляцией подвижного слоя сорбента
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Мембранные технологии
Концентрирование
Концентрирование
Концентрирование
Концентрирование
Товарная форма продукта
Товарная форма продукта
Товарная форма продукта
Товарная форма продукта
Товарная форма продукта
Товарная форма продукта
Товарная форма продукта
Товарная форма продукта
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Впервые эта система введена в действие Всемирной организацией
Впервые эта система введена в действие Всемирной организацией
Для участия в системе необходимо наличие в стране трех условий: 1)
Для участия в системе необходимо наличие в стране трех условий: 1)
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Классификация помещений производства лекарственных средств
Классификация помещений производства лекарственных средств
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
Организация производственного процесса и контроля качества продукции в
САМОИНСПЕКЦИЯ Целью самоинспекции является оценка производителем
САМОИНСПЕКЦИЯ Целью самоинспекции является оценка производителем

Презентация на тему: «Биотехнология». Автор: 306a-zagrebelny. Файл: «Биотехнология.ppt». Размер zip-архива: 3325 КБ.

Биотехнология

содержание презентации «Биотехнология.ppt»
СлайдТекст
1 Биотехнология

Биотехнология

Часть 2. Фракционирование клеточных экстрактов

Новосибирский государственный университет

2 Фракционирование продуктов биосинтеза

Фракционирование продуктов биосинтеза

После завершения процесса выращивания культуры продуцента получается система, содержащая наряду с целевым продуктом все остальные компоненты: остатки питательной среды, компоненты клеток микроорганизмов и продукты их метаболизма. Дальнейшие стадии процесса направлены на выделение из этой сложной смеси целевого продукта, что часто представляет собой достаточно сложную задачу и требует использования разнообразных технологических приемов.

2

3 3

3

4 Специфичность технологических стадий

Специфичность технологических стадий

Технологический процесс – совокупность и последовательность технологических процедур, приводящих к получению целевого продукта из исходного сырья. При разработке промышленного технологического процесса важными являются некоторые критерии для сравнения эффективности процесса и его отдельных стадий.

4

5 Специфичность технологических стадий

Специфичность технологических стадий

Фазы процесса: I – фаза грубого фракционирова-ния; II – фаза основной очистки; III – фаза финишной очистки

Обобщенное представление технологического процесса

5

6 Специфичность технологических стадий

Специфичность технологических стадий

Для сравнения специфичности отдельных стадий технологического процесса можно ввести величину – коэффициент специфичности:

Этот коэффициент представляет собой отношение степени обогащения продукта на i+1-й стадии процесса к степени обогащения на предыдущей i-й стадии.

При этом можно условиться, что специфичной считается стадия, для которой k ? 5. Эта величина выбрана, исходя из того, что три последовательных стадии с таким коэффициентом позволяют очистить продукт ~ в 100 раз.

6

7 Этапы фракционирования

Этапы фракционирования

Полученная на стадии ферментации культура продуцента содержит целевой продукт либо в биомассе клеток (внутриклеточный продукт), либо в культуральной жидкости (внеклеточный продукт). В любом из этих вариантов первой стадией фракционирования культуры является отделение клеточной массы от жидкой фазы – культуральной жидкости. Разделение твердой (биомасса) и жидкой фаз сводится к задаче разделения суспензий.

7

8 Этапы фракционирования

Этапы фракционирования

Задача разделения суспензий решается обычно методами седиментации. Если представить себе систему в виде суспензии малых сферических частиц в жидкости, движение этих частиц может быть описано (приближенно) уравнением Стокса:

U – скорость движения частиц; g – ускорение силы тяжести; D – диаметр частицы; ? – вязкость дисперсионной среды ?,?0 – плотность дисперсной фазы и дисперсионной среды соответственно

8

9 Этапы фракционирования

Этапы фракционирования

Для малых частиц скорость седиментации в поле силы тяжести мала, тем более, что она снижается за счет броуновского движения. В связи с этим седиментацию проводят в специальных аппаратах – центрифугах или сепараторах, в которых система помещается в центробежное поле, в котором ускорение свободного падения заменяется центробежным ускорением.

9

10 Этапы фракционирования

Этапы фракционирования

Конструкции роторов центрифуг – проточные роторы: осветляющий (А) и сепарирующий (Б)

А

Б

Регулировочное кольцо

Выход легкой фазы

Легкая фаза

Выход тяжелой фазы

Тяжелая фаза

Осадок

10

11 Этапы фракционирования

Этапы фракционирования

Попытаемся проанализировать работу проточной центрифуги. В режиме вращения жидкость располагается в роторе в виде цилиндра высотой h, внешним радиусом r2 и внутренним радиусом r1. Объем этого цилиндра, очевидно, равен Если мы будем подавать в ротор суспензию со скоростью Q (см3/с), то время пребывания в роторе объема суспензии V равно t=V /Q, а путь, который преодолевает частица в радиальном направлении под действием центробежного поля, равен

11

12 Этапы фракционирования

Этапы фракционирования

Далее: Видно, что первый сомножитель (?) в правой части этого уравнения определяется свойствами разделяемой системы (размер частиц, различие плотностей фаз, вязкость среды), второй (?) – параметрами центрифуги (объем и диаметр ротора, скорость его вращения). Этот критерий можно использовать при масштабировании процессов центрифугирования.

12

13 Этапы фракционирования

Этапы фракционирования

В трубчатом роторе непрерывного действия частица перемещается в двух направлениях – вертикально, вдоль оси ротора вместе с потоком подаваемой суспензии, и радиально по направлению к стенке ротора – под влиянием центробежной силы. Для радиальной составляющей: Для вертикальной составляющей:

13

14 Этапы фракционирования

Этапы фракционирования

Из этих уравнений Интегрируя полученное уравнение в пределах от r1 до r2 (по r) и от 0 до h (по z), получаем: или

14

15 Этапы фракционирования

Этапы фракционирования

Сопоставляя приведенные выше выражения, мы можем заметить, что величина ? зависит только от параметров центрифуги и не зависит от природы разделяемой суспензии и может рассматриваться как критерий выбора режима и центрифуги.

15

16 Этапы фракционирования

Этапы фракционирования

Градиентное центрифугирование Помимо конструктивных параметров центрифуги скорость осаждения может регулироваться путем подбора соотношения плотностей дисперсной фазы и дисперсионной среды. Этот способ оказывается пригодным для фракционирования клеточных органелл или даже макромолекул. Одним из вариантов использования этого принципа является центрифугирование в градиенте плотности растворителя. Если в состав растворителя ввести компонент, дающий растворы высокой плотности, то под влиянием центробежного поля в роторе центрифуги установится градиент концентрации этого компонента в соответствии с барометрической формулой Больцмана:

16

17 Этапы фракционирования

Этапы фракционирования

Формирование градиента плотности. Утяжеляющие компоненты В качестве «тяжелых» компонентов могут использоваться соли, такие как CsCl (? = 1,905), Cs2SO4 (? = 1,80), RbCl (? = 1,35) и ряд других. В соответствии с уравнением для скорости движения частиц в поле сил в зоне, где плотность дисперсной фазы станет равной плотности среды, скорость станет равной 0, и движение частиц прекратится. Такая плотность растворителя называется плавучей плотностью для данного вещества. Частицы вещества, оказавшиеся в области раствора, где плотность растворителя превышает их плавучую плотность, всплывают в зону, где эти плотности становятся равными.

17

18 Максимально достижимые плотности растворов градиентообразующих веществ

Максимально достижимые плотности растворов градиентообразующих веществ

Компонент

Концентрация, %

Температу-ра, oC

Плотность, г / см3

Показатель преломления

CsCl

65

25

1,905

1,4183

Сs2(so4)

25

1,80

CsI

25

1,55

CsBr

25

1,50

RbCl

25

1,35

Сахароза

66

20

1,322

1,4555

Метризамид

80

20

1,430

Урограффин

1,45

Фиколл

50

20

1,171

Перколл

1,30

18

19 Этапы фракционирования

Этапы фракционирования

Структура урограффина – смеси натриевой и 1-дезокси-1-(метиламино)-d-глюцитовой (метилглюцитовой) солей диатризоевой кислоты.

19

20 Этапы фракционирования

Этапы фракционирования

Конструкции роторов центрифуг – проточный ротор препаративной лабораторной центрифуги

20

21 Этапы фракционирования

Этапы фракционирования

Конструкции центрифуг – проточные роторы: тарельчатый

21

22 Этапы фракционирования

Этапы фракционирования

Центрифуга непрерывного действия с тарельчатым ротором. Разделяемая суспензия поступает в загрузочную линию сверху, попадает в нижнюю часть камеры и переходит в раздели-тельное пространство, наполненное кони-ческими тарелками. На врезке показано движение жидкой фазы и осадка, который собирается у стенки камеры и вытесняется в разгрузочный канал. Осветленная жидкая фаза поднимается в верхнюю часть камеры и выходит в выводной канал.

22

23 Разделение суспензий фильтрованием

Разделение суспензий фильтрованием

Суспензии микробных культур могут быть разделены и с помощью фильтрования. Этот прием используется при стерилизации питательных сред и может быть использован при разделении суспензии микроорганизмов после культивирования. Важное различие: в процессах стерилизации концентрация клеток мала, так что большой нагрузки на фильтрующий материал не возникает. При разделении культуральной суспензии концентрация клеток на много порядков выше. Кроме того, в случае отделения клеток от культуральной жидкости требования к содержанию микробных клеток в фильтрате менее строги, чем при стерилизации.

23

24 Разделение суспензий фильтрованием

Разделение суспензий фильтрованием

Конструкции фильтров довольно разнообразны. Существуют фильтры, работающие под вакуумом, под давлением, существуют фильтрующие центрифуги, в которых раствор продавливается через цилиндрическую фильтрующую перегородку действием центробежной силы. Важным обстоятельством, снижающим производительность работы фильтрующих аппаратов является возрастание сопротивления потоку жидкости через фильтрующую перегородку по мере накопления слоя осадка на поверхности фильтра. Происходит также «забивание» пор фильтрующего материала, также приводящее к снижению скорости протока через фильтрующую перегородку.

24

25 Разделение суспензий фильтрованием

Разделение суспензий фильтрованием

Поток фильтруемой суспензии

Слой осадка; заметен градиент плотности

По мере накопления осадка слой его становится толще, а давление со стороны потока уплотняет осадок. Сопротивление потоку растет. Наблюдается явление концентрационной поляризации фильтра. Наиболее сильно проблемы заметны, когда направление фильтрации перпендикулярно плоскости фильтра.

Проблемы устраняются перемешиванием объема перед фильтрующей перегородкой и созданием тангенциального потока суспензии по отношению к фильтрующей поверхности

25

26 Разделение суспензий фильтрованием

Разделение суспензий фильтрованием

Ротационный вакуум-фильтр со шнуровым съёмом осадка.

26

27 Общие принципы фракционирования экстрактов биологического сырья

Общие принципы фракционирования экстрактов биологического сырья

После отделения биомассы продуцента от культуральной жидкости начинается процесс очистки целевого продукта, который содержится либо в клеточной массе, либо в культуральной жидкости. В обоих случаях исходной является весьма сложная многокомпонентная смесь различных по своей природе соединений, задача разделения которых всегда достаточно сложна. Особенно сложна задача разделения белковых компонентов, которые представляют собой достаточно близкие по химической природе соединения – полимеры аминокислот, так что различия в их свойствах, на которых можно строить стратегию фракционирования, относительно невелики.

27

28 Общие принципы фракционирования экстрактов биологического сырья

Общие принципы фракционирования экстрактов биологического сырья

Если продукт находится в культуральной жидкости (внеклеточный продукт), можно сразу переходить к ее фракционированию. Если продукт находится в составе биомассы (внутриклеточный продукт), необходимо предварительно разрушить клетки (процедура дезинтеграции), чтобы получить некоторый раствор, из которого далее можно выделять продукт.

28

29 Дезинтеграция

Дезинтеграция

Дезинтеграция клеточной массы, равно как и органов и тканей животных и растений представляет собой один из важнейших элементов биотехнологического процесса. Эту процедуру осуществляют либо физическими, либо химическими, либо ферментативными методами. Встречаются случаи, когда используются и комбинации этих приемов.

29

30 Механическая дезинтеграция

Механическая дезинтеграция

Наиболее распространенными в промышленности являются физические методы, среди которых, в свою очередь, чаще всего применяются баллистические методы дезинтеграции клеточной массы. Сущность этой группы методов состоит в том, что биомассу подвергают воздействию удара или истирания. В первом случае биомассу помещают в цилиндрический барабан, вращающийся вокруг оси и наполненный шариками из тяжелого твердого материала (металл или фарфор). При вращении барабана шарики перекатываются и ударяют по агломератам биомассы, причем эти удары происходят достаточно часто и в разных направлениях. В конце концов, это приводит к разрушению клеточных стенок и получению сравнительно однородного вязкого раствора, в котором находится содержимое клеток.

30

31 Механическая дезинтеграция

Механическая дезинтеграция

Механическая дезинтеграция: вращающийся барабан с рубашкой для охлаждения. В барабан загружены шары из твердого материала (керамики), а затем загружается разрушаемая биомасса. При вращении барабана происходит раздавливание клеток за счет столкновения с шарами, которые вращаются вокруг собственных осей, падают сверху на частицы биомассы. При таких соударениях и трении происходит разогрев содержимого барабана, что приводит к необходимости охлаждения, чтобы избежать термоинактивации компонентов клеточного экстракта.

31

32 Механическая дезинтеграция

Механическая дезинтеграция

Ход дезинтеграции в протоке можно описать уравнением: где A - степень дезинтеграции, % K - константа скорости дезинтеграции, f - объемная скорость, л/час. По этому уравнению можно рассчитывать: Степень дезинтеграции при заданной скорости протока; Скорость протока, обеспечивающую заданную степень дезинтеграции Величина К определяется природой разрушаемых клеток

32

33 Механическая дезинтеграция

Механическая дезинтеграция

Другим способом механической дезинтеграции клеток является экструзия. Сущность этого способа заключается в том, что суспензию клеточной массы под высоким давлением (до 100 ати) продавливают через узкое отверстие в камеру с нормальным давлением. При этом из-за большого перепада давления вода, попавшая под действием высокого давления в клетки, быстро выходит из них и разрушает клеточную стенку. При создании высокого давления и продавливании суспензии через узкое отверстие происходит разогрев, так что во избежание потерь продукта из-за термоинактивации и в этом случае необходимо охлаждение суспензии. Степень разрушения клеток при таком способе составляет до 90%. В лабораторной практике применяется способ разрушения клеток, основанный на чередовании быстрого замораживания и оттаивания клеточной массы. При этом вода, входящая в состав клеток, замерзает, образовавшиеся частицы льда, превосходящие по объему воду в жидком состоянии, разрывают клеточную стенку. Повторение таких процедур несколько раз приводит к достаточно полному разрушению клеточных стенок.

33

34 Ультразвуковая дезинтеграция

Ультразвуковая дезинтеграция

Помимо механических способов разрушения клеток, используются приемы, основанные на воздействии на клетки ультразвука. Под действием ультразвукового поля клетки испытывают попеременные сжатия и растяжения, скручивание в различных направлениях, что, в конце концов, приводит к разрыву клеточной стенки и разрушению клетки. Как и в случае баллистических методов, операция дезинтеграции с помощью ультразвука может осуществляться как в периодическом, так и в непрерывном (проточном) режиме. Для этой цели сконструированы специальные ячейки, позволяющие прокачивать суспензию разрушаемой биомассы (со скоростью до нескольких литров в минуту при концентрации клеток в суспензии до 20 %) и поддерживать при этом температуру не свыше 2–4oС. Степень разрушения и в этом случае оценивается по выходу белка в раствор и составляет до 60 % за один цикл. Для более полного разрушения биомассу можно возвращать в цикл.

34

35 Ультразвуковая дезинтеграция

Ультразвуковая дезинтеграция

Кинетика выделения белка в раствор описывается уравнением

где x – доля перешедшего в раствор белка от общего его количества в клетках, k – константа скорости выделения белка в раствор (в пределах 20–60% не зависит от концентрации клеток в суспензии). Для проточного аппарата такая зависимость имеет вид:

Где kv – константа скорости выделения белка для камеры объемом V; xeq – доля перешедшего в раствор белка в равновесном состоянии; y – скорость протока суспензии клеток через ячейку.

35

36 Химическая дезинтеграция

Химическая дезинтеграция

Иногда более удобным оказывается разрушение клеточной оболочки за счет перевода в раствор отдельных ее компонентов – изменения ее состава и структуры, что делает ее более проницаемой для клеточного содержимого. Одним из таких методов является детергентный лизис клеток. Биомасса продуцента обрабатывается каким-либо из детергентов, который растворяет липидные компоненты клеточной стенки, после чего внутриклеточное содержимое через образовавшиеся поры вытекает в окружающую среду. Подобный процесс также может проводиться в непрерывном режиме.

36

37 Химическая дезинтеграция

Химическая дезинтеграция

В аппарат 1 загружается суспензия биомассы в растворе литического агента. Этот аппарат является резервуаром, из которого суспензия попадает в теплообменник 2, где подогревается до температуры, при которой происходит лизис (в аппарате 3). После пребывания в реакторе 3 суспензия попадает в другой теплообменник, где она охлаждается – во избежание длительного пребывания при повышенной температуре, что может привести к разрушению целевого продукта. Время контакта биомассы с литическим агентом задается скоростью прокачивания суспензии через систему и рассчитывается, исходя из скорости лизиса данной биомассы данным литическим агентом.

1 2 3 2 1- резервуар с суспензией биомассы в растворе литического агента 2 – теплообменники 3 – реактор для экстракции

37

38 Химическая дезинтеграция

Химическая дезинтеграция

В качестве литических агентов используются детергенты, но по аналогичной схеме могут использоваться и ферменты, разрушающие клеточные стенки продуцента. Известны ферменты, пригодные для лизиса клеток различных микроорганизмов. В случае бактерий часто используют лизоцим куриных яиц, который расщепляет гликопротеидный каркас клеточных стенок. Наиболее приемлемо использование лизоцима для разрушения клеточных стенок грам-положительных бактерий, однако и грам-отрицательные бактерии в достаточной степени восприимчивы к действию лизоцима. Клетки дрожжей к лизоциму устойчивы, так что приходится применять другие ферменты. Такие ферменты найдены, они продуцируются бактериями и могут с успехом использоваться как наиболее щадящие литические агенты для сохранения лабильных внутриклеточных продуктов.

38

39 Фракционирование клеточных экстрактов

Фракционирование клеточных экстрактов

Наиболее сложным представляется разделение белковых компонентов клеточного содержимого. Причина в сложности и полифункциональности белковых молекул и в их гетерополимерной природе, создающей условия для внутримолекулярной подвижности отдельных сегментов молекулы друг относительно друга, что приводит к возможности возникновения близких по энергии, но сильно отличающихся по функциональным возможностям состояний.

Схематическое изображение белковой молекулы в растворе. Видны спиральные фрагменты, элементы ?-структуры, гидрофильные и гидрофобные участки молекулы, диполи воды во взаимодействии с белковой глобулой.

39

40 Фракционирование клеточных экстрактов

Фракционирование клеточных экстрактов

При сближении друг с другом частицы белка, окруженные гидратной «шубой» и ионной атмосферой

Белковая глобула в растворе представляет собой аналог коллоидной мицеллы. На поверхности глобулы формируется двойной электрический слой, со стороны раствора возникают плотная и диффузная части двойного слоя. Потенциал, приходящийся на диффузную часть, называется электрокинетическим потенциалом. Диффузная часть образует ионную атмосферу.

40

41 Фракционирование клеточных экстрактов

Фракционирование клеточных экстрактов

Задача разработки процедуры очистки белка из столь сложной смеси состоит в использовании малых различий в свойствах белков для их разделения.

Ионная атмосфера и гидратная оболочка формируют энергетический барьер, препятствующий слипанию белковых глобул при их сближении. Ионная атмосфера вызывает взаимное электростатическое отталкивание частиц при их сближении. Гидратная оболочка препятствует взаимодействию поверхностей белковых глобул за счет насыщения энергии полярных и ионных группировок взаимодействием с дипольными молекулами воды.

U

r

? - потенциал кинетического барьера

41

42 Фракционирование клеточных экстрактов

Фракционирование клеточных экстрактов

Распределение зарядов и полярных групп на поверхности разных белков существенно различается. Доля заряженных группировок зависит от рН среды. Радиус ионной атмосферы зависит от ионной силы раствора. Прочность гидратной оболочки зависит от диэлектрической постоянной раствора.

42

43 Фракционирование клеточных экстрактов

Фракционирование клеточных экстрактов

Все эти параметры влияют на величину энергетического барьера слипания, для разных белков условия преодоления барьера наступают при разных обстоятельствах, что и позволяет фракционировать белковые смеси. Белки различаются по величине изоэлектрической точки – значении рН, при котором суммарный заряд белковой глобулы равен 0. При этом барьер слипания преодолевается довольно легко, частицы начинают агрегировать, белок выпадает в осадок. При повышении ионной силы раствора двойной слой сжимается, электрокинетический потенциал понижается. Это также приводит к снижению барьера слипания и к агрегации белковых частиц с образованием осадка. При добавлении в среду органических растворителей понижается диэлектрическая постоянная, что также способствует снижению барьера и агрегации белковых частиц.

43

44 Фракционирование клеточных экстрактов

Фракционирование клеточных экстрактов

На этих принципах основано фракционирование белковых смесей ступенчатым солевым осаждением. В качестве осадителя чаще всего используют сульфат аммония, который не вызывает денатурацию белков и способствует длительному сохранению их активности в осадке. При разработке технологии фракционирования белковых экстрактов осаждением сульфатом аммония к раствору добавляют твердую соль порциями, медленно, с осторожным перемешиванием при пониженной температуре. Концентрацию сульфата аммония выражают в долях от концентрации насыщенного раствора (степень насыщения). Первую порцию добавляют до момента помутнения раствора, оставляют до созревания осадка при пониженной температуре (на несколько часов), осадок отделяют центрифугированием, затем добавляют новую порцию соли до момента помутнения, далее проводятся те же операции, пока не будет достигнута насыщающая концентрация раствора сульфата аммония. Получают серию осадков, в которых определяют концентрацию (активность) целевого продукта.

44

45 Фракционирование клеточных экстрактов

Фракционирование клеточных экстрактов

Аналогичным образом проводится разработка технологии фракционирования белковых смесей селективным осаждением органическими растворителями. В качестве осадителей используют этанол, ацетон, изопропанол и др. растворители. К сильно охлажденному раствору добавляют растворитель порциями, медленно, с осторожным перемешиванием при пониженной температуре. Первую порцию добавляют до момента помутнения раствора, оставляют до созревания осадка при пониженной температуре (на несколько часов), осадок отделяют центрифугированием, затем добавляют новую порцию растворителя до момента помутнения, далее проводятся те же операции, пока не будет достигнута концентрация раствора, при которой осаждаются все содержащиеся в смеси белки. Поскольку органические растворители вызывают денатурацию белков, перед добавлением новой порции растворителя смесь охлаждают до возможно более низкой вплоть до отрицательных значений температуры, что возможно из-за понижения температуры замерзания раствора за счет добавок органического растворителя. Помимо органических растворителей в качестве осадителей могут использоваться водорастворимые полимеры.

45

46 Фракционирование клеточных экстрактов

Фракционирование клеточных экстрактов

lgM

6.0 5.0 4.0

Приблизительные области осаждения некоторых белков из экстрактов мышц различными концентрациями ацетона при 5° С, рН 6,5, I = 0,1

20 40 60 80 Концентрация ацетона, % (v / v)

Фосфорилаза Пируваткиназа Альдолаза Лактатдегидрогеназа Энолаза Креатинкиназа ФосфоглицераткиназаМиокиназа Миоглобин Парвальбумин

46

47 Аффинное осаждение

Аффинное осаждение

Для повышения эффективности осаждения могут применяться аффинные методы. В случае, например, ферментов, связывающихся с нуклеиновыми кислотами (ДНК-полимераза 1, РНК-полимераза из E. сoli) при осаждении НК катионными агентами происходит соосаждение ферментов. В других ситуациях аффинные процедуры можно конструировать на основе информации о свойствах фермента. При очистке ферментов, способных связываться с полисахаридами, предложено использовать в качестве осадителя альгиновую кислоту. Фермент связывается с этим осадителем, а затем в раствор добавляют соль кальция, с которым альгиновая кислота образует гель, выпадающий в осадок вместе со связавшимся с ним ферментом. После отделения от раствора к осадку добавляют ЭДТА, которая связывает ионы Са, гель растворяется и фермент освобождается из комплекса.

47

48 Аффинное осаждение

Аффинное осаждение

Аффинное осаждение амилазы из проростков пшеницы: Дорожка 1 – сырой препарат (экстракт проростков) Дорожка 2 – очищенный препарат Количество белка на геле одинаковое; Элюция мальтозой.

Альгиновая (поли-D-ман-нуроновая) кислота

M. Sardar & M. N. Gupta. Alginate beads as an affinity material for alpha amylases// Bioseparation 7: 159–165, 1998.

48

49 Распределительные методы

Распределительные методы

- Коэффициент распределения

Одним из такого рода приемов является распределение вещества между двумя несмешивающимися жидкими фазами, использующееся в технологии так называемого противоточного распределения, в ходе которого осуществляется последовательное многократное распределение вещества между двумя жидкими фазами.

Состав фаз подбирается таким образом, чтобы коэффициенты распределения компонентов смеси были удобными для разделения

49

50 Распределительные методы

Распределительные методы

Устройство для противоточного распределения состоит из множества ячеек (1,2,3 на схеме), в которые залита «тяжелая» неподвижная фаза. В ячейку 1 заливают «легкую» подвижную фазу, вводят разделяемую смесь, встряхивают полученную систему, дают расслоиться. Осуществлено первое распределение – компонентов смеси между фазами в соответствии с коэффициентами распределения. Затем подвижная фаза переносится из ячейки 1 в ячейку 2 – первый перенос. Далее операции распределения повторяются, производится перенос в ячейку 3 и процесс продолжается.

50

51 Распределительные методы

Распределительные методы

После распределения вещества между фазами концентрация нашего вещества в верхней фазе будет равна c1, в нижней фазе – c2. Пусть концентрация вносимого с подвижной фазой вещества равна c0, объем подвижной фазы – V. Тогда количество растворенного вещества равно c0V. Будем считать, что объемы жидких фаз в ячейках равны. Тогда после установления равновесного распределения будет соблюдаться следующее условие материального баланса:

Концентрации компонента в каждой фазе:

51

52 Распределительные методы

Распределительные методы

После первого переноса общее количество вещества в ячейках 1 и 2 будет равно соответственно:

Аналогичным образом можно описать и последующие переносы и распределения. Однако из уже приведенных данных можно видеть, что количество вещества в ячейках распределяется по биномиальному закону

52

53 Распределительные методы

Распределительные методы

Номер ячейки

1

2

Подвижная фаза

Неподвижная фаза

Общее количество вещества в ячейке

53

54 Распределительные методы

Распределительные методы

При этом количество вещества Q после n переносов в k-й ячейке определяется по формуле общего члена биномиального распределения:

В зависимости от величин a и n при некотором k будет наблюдаться максимальное значение Q. Очевидно, что разные компоненты разделяемой смеси имеют различные значения a и, следовательно, максимальное значение Q будет для разных компонентов смеси достигаться при разных k. Таким образом и достигается разделение компонентов смеси.

54

55 Распределение в системах с несмешивающимися водными растворами

Распределение в системах с несмешивающимися водными растворами

полимеров

Растворы полимеров, каждый из которых хорошо растворим в воде, при смешении часто образуют две фазы. Впервые такое явление наблюдал Байеринк в 1896 г.: смесь желатина, агара и воды в определенном диапазоне концентраций разделяется на две фазы, причем верхняя фаза богата желатином, нижняя – агаром. Альбертсон показал, что такие системы могут быть эффективно использованы для фракционирования белковых смесей.

55

56 Системы с несмешивающимися водными растворами полимеров

Системы с несмешивающимися водными растворами полимеров

В и С – узловые точки

Описанная система может быть представлена на фазовой диаграмме. Кривая – бинодаль. Выше кривой система двухфазна, ниже кривой – однофазна. Прямая, соединяющая точки A,B и C, строится по экспериментальным данным. Точка В соответствует составу нижней фазы, точка С – составу верхней фазы. Соотношение отрезков АВ и ВС отражает соотношение объёмов фаз.

56

57 Системы с несмешивающимися водными растворами полимеров

Системы с несмешивающимися водными растворами полимеров

Такая система подвержена влиянию многих факторов. Их вклад в процессы в системе можно отразить в уравнении: ln ? = ln ?0 + ln ?el +ln ?hfob + ln ?biosp + ln?size + ln?conf Индексы обозначают вклад электростатических, гидрофобных, биоспецифических взаимодействий, молекулярного размера и конформационных свойств в величину коэфициента распределения. Точно описать термодинамику такой системы невозможно.

57

58 Водные двухфазные системы

Водные двухфазные системы

Неионный полимер

Неионный полимер

Полипропиленгликоль

Полипропиленгликоль

Полипропиленгликоль

Полипропиленгликоль

Полиэтиленгликоль

Поливиниловый спирт

Оксипропилдекстран

Декстран

Полиэтиленгликоль

Полиэтиленгликоль

Полиэтиленгликоль

Полиэтиленгликоль

Поливиниловый спирт

Поливинилпирролидон

Декстран

Фиколл

58

59 Водные двухфазные системы

Водные двухфазные системы

Неионный полимер

Неионный полимер

Поливиниловый спирт

Поливиниловый спирт

Метилцеллюлоза

Декстран

Поливинилпирролидон

Поливинилпирролидон

Метилцеллюлоза

Декстран

Метилцеллюлоза

Декстран

Полимер

Низкомолекуляр-ный компонент

Полипропиленгликоль

Полипропиленгликоль

Фосфат калия

Глицерин

Водные двухфазные системы

59

60 Водные двухфазные системы

Водные двухфазные системы

Полимер

Низкомолекулярный компонент

Полиэтиленгликоль

Полиэтиленгликоль

Неорганические соли

Глюкоза, мальтоза и т.п.

Декстран

Декстран

Бутилцеллозольв

Пропанол, изопропанол

Водные двухфазные системы

60

61 Водные двухфазные системы

Водные двухфазные системы

Полиэлектролит

Неионный полимер

ДЭАЭ-декстран, HCl

ДЭАЭ-декстран, HCl

Поливиниловый спирт

Метилцеллюлоза

Na-декстран cульфат

Na-декстран cульфат

Na-декстран cульфат

Полипропиленгликоль

Полиэтиленгликоль, NaCl

Декстран, NaCl

61

62 Водные двухфазные системы

Водные двухфазные системы

Полиэлектролит

Полиэлектролит

Na-декстран cульфат

Na-декстран cульфат

Na – карбоксиметил- декстран

Карбоксиметилцеллюлоза

62

63 Водные двухфазные системы

Водные двухфазные системы

Белок

Белок

Декстран 500 (9%)- ПЭГ: мол вес ПЭГ

Декстран 500 (9%)- ПЭГ: мол вес ПЭГ

Декстран 500 (9%)- ПЭГ: мол вес ПЭГ

Декстран 500 (9%)- ПЭГ: мол вес ПЭГ

4000

6000

20000

40000

Цитохром С

12384

0,17

0,17

0,13

0,12

Овальбумин

45000

1,25

0,85

0,50

0,50

Бса

69000

0,52

0,34

0,14

0,11

Лдг

140000

0,13

0,08

0,05

0,10

Каталаза

250000

0,82

0,38

0,16

0,10

Мол. вес белка

Мол. вес белка

Коэффициенты распределения белков в системах Декстран 500/ПЭГ

Зависимости от мол. веса ПЭГ и от размеров белков не прослеживается

63

64 Водные двухфазные системы

Водные двухфазные системы

Технологическое оборудование для двухфазного распределения

Схематическое представление дискового тарельчатого контактора. Непрерывная выгрузка внутриклеточных продуктов с центрифугальной экстракцией в системе ПЭГ/соль

Схема колонного экстрактора с перфорированными тарелками Описаны и другие устройства подобного типа.

Teresa cunha and raquel aires-barros. Large-scale extraction of proteins//MOLECULAR BIOTECHNOLOGY volume 20, 2002, Р. 29-40

64

65 Аффинные методы в двуфазном распределении

Аффинные методы в двуфазном распределении

Специфичность очистки белков распределением в двухфазных системах удается повысить применением аффинных принципов. Один из полимеров подвергается модификации путем присоединения к нему аффинного лиганда, специфичного к определенному белку или классу белков. При этом может происходить даже обращение коэффициента распределения.

65

66 Аффинные методы в двуфазном распределении

Аффинные методы в двуфазном распределении

При конструировании продуцентов белков методами генной инженерии возможно создание конструкций, специально предусмотренных для эффективной очистки продуктов путем использования аффинных подходов. При конструировании суперпродуцента белка А Staphylococcus aureus, широко используемого в иммуноферментном анализе, к последовательности гена были присоединены фрагменты, кодирующие пептиды, обогащенные остатками триптофана. Это обеспечивало преимущественное концентрирование рекомбинантного белка в одной из фаз.

Kristina Berggren, Folke Tjerneld, Andres Veide. Peptide fusion tags with tryptophan and charged residues for control of protein partitioning in PEG–potassium phosphate aqueous two-phase systems//Bioseparation 9: 69–80, 2000.

66

67 Хроматографические методы

Хроматографические методы

При конструировании процессов очистки продуктов биотехнологического процесса как правило приходится использовать несколько последовательных процедур фракционирования, основанных на различных принципах. Широкое применение нашли методы хроматографического фракционирования сложных смесей.

67

68 Хроматографические методы

Хроматографические методы

Слово “хроматография” состоит из двух греческих корней: хромос (цвет) и графо (пишу). Перевод его может звучать как “цветопись”. Изобрел этот метод русский ботаник Михаил Семёнович Цвет при попытках разделения растительных пигментов, в частности, хлорофиллов. В качестве сорбента он использовал окись алюминия, в процессе разделения на колонке формировались окрашенные зоны, что и послужило основанием для введения термина.

Михаил Семёнович Цвет (1872—1919)

68

69 Хроматографические методы

Хроматографические методы

В настоящее время используются различные виды хроматографического разделения, основанные на различных типах взаимодействия компонентов разделяемой смеси и сорбента: Распределительная хроматография; Хроматография в обращенных фазах; Ионообменная хроматография; Адсорбционная хроматография; Хроматография на молекулярных ситах (гель-проникающая хроматография).

69

70 Хроматографические методы

Хроматографические методы

Ионообменная хроматография является одним из наиболее распространенных типов хроматографического разделения. Сорбент - твердый носитель, содержащий ионизируемые в водных растворах функциональные группы, с которыми связываются с тем или иным сродством компоненты разделяемой смеси. Распределительная хроматография – сорбент представляет собой нейтральный твердый носитель, на котором сорбирована неподвижная фаза. Подвижной фазой в данном случае является растворитель, процесс основан на распределении компонентов смеси между подвижной и неподвижной жидкими фазами, разделение достигается за счет различия в коэффициентах распределения компонентов разделяемой смеси между подвижной и неподвижной фазами. Обычно неподвижная фаза более полярна. Если неподвижная фаза более гидрофобна – хроматография в обращенных фазах (RPC – Reversed Phase Chromatography).

70

71 Хроматографические методы

Хроматографические методы

Адсорбционная хроматография - сорбент представляет собой твердый носитель, на котором происходит обратимая сорбция компонентов разделяемой смеси за счет дисперсионного взаимодействия их с поверхностными структурами твердой фазы; разделение достигается за счет различия в константах равновесия связывания компонентов смеси с поверхностью сорбента; Хроматография на молекулярных ситах (гель-проникающая хроматография, гель-фильтрация); сорбент представляет собой гранулы геля, имеющие поры, в которые могут проникать молекулы компонентов с размером ниже некоторой величины и не могут проникать молекулы большего размера. При этом в колонке объем растворителя, доступный для молекул разного размера, оказывается различным: относительно малые молекулы диффундируют как в межгранульном, так и во внутригранульном объеме, крупные молекулы могут диффундировать лишь в межгранульном пространстве. Разделение достигается за счет разной скорости перемещения частиц с разными размерами молекул по колонке, при этом частицы большего размера движутся с большей скоростью;

71

72 Хроматографические методы

Хроматографические методы

Аффинная хроматография. Сорбент представляет собой твердый носитель, к которому химически присоединены специальные группировки - лиганды, избирательно связывающие какой-либо из компонентов разделяемой смеси; остальные компоненты раствора не взаимодействуют с носителем и выходят в свободном объеме колонки). Существуют приемы хроматографии, основанные и на других принципах, так что арсенал хроматографических методов достаточно разнообразен.

72

73 Ионообменная хроматография

Ионообменная хроматография

В ионообменной хроматографии наиболее часто используются следующие типы носителей: – гранулированные сополимеры стирола и дивинилбензола. В качестве ионообменных групп в такие полимеры вводят либо аминогруппы с последующим превращением их в четвертичные аммониевые группировки (для получения сильных анионитов), либо сульфогруппы (для получения сильных катионитов); используются также сополимеры акриловой кислоты и дивинилбензола, являющиеся слабыми катионитами. – гранулированные полисахариды: целлюлоза, поперечно-сшитые производные декстрана, агарозы, модифицированные химически с введением ионогенных группировок кислотного или основного характера.

73

74 Ионообменная хроматография

Ионообменная хроматография

Для синтетических полимерных сорбентов характерны высокая ионообменная емкость при существенной гидрофобности матриц, высокая жесткость и малый размер пор в гранулах. Преимущественно используются для разделения низкомолекулярных компонентов (аминокислоты, нуклеотиды, антибиотики и т. п.). Биополимеры (белки, нуклеиновые кислоты, полисахариды) на таких ионообменниках фракционировать неудобно из-за высокой неспецифической и практически необратимой сорбции и малой емкости этих носителей для высокополимерных соединений.

74

75 Ионообменная хроматография

Ионообменная хроматография

Фракционирование белков предпочтительно осуществлять на полисахаридных сорбентах, которые содержат многочисленные гидроксильные группы и, таким образом, имитируют водное окружение – наиболее благоприятное для белковых веществ. Такое окружение минимизирует денатурирующее воздействие со стороны окружающей среды. Выбор сорбента для хроматографической очистки существенно облегчается, если имеется предварительная информация о свойствах целевого продукта.

75

76 Ионообменная хроматография

Ионообменная хроматография

Формула

Название

Обозначение

Сильные катиониты

Сильные катиониты

Сильные катиониты

Слабые катиониты

Слабые катиониты

Слабые катиониты

-SO3-

Сульфо-

S-

-CH2SO3-

Сульфометил-

SM-

-C2H4SO3-

Сульфоэтил-

SE-

-C3H6SO3 -

Сульфопропил-

SP-

-PO32-

Фосфо-

Р-

-Соо-

Карбокси-

С-

-Сн2соо-

Карбоксиметил-

См-

76

77 Ионообменная хроматография

Ионообменная хроматография

Формула

Название

Обозначение

Сильные аниониты

Сильные аниониты

Сильные аниониты

Слабые аниониты

Слабые аниониты

Слабые аниониты

-CH2 N+(CH3)3

Триметиламинометил-

Там-

-C2H4 N+(C2H5)3

Триэтиламиноэтил-

Теае-

-C2h4n+(c2h5 )2 сh2сh(oh)ch3

Диэтил-2-оксипропил- аминоэтил-

QAE-

-С2h4nh3+

Аминоэтил-

Ае-

-С2н4n+h(c2h5)2

Диэтиламиноэтил-

DEAE-

-(C2H4 N сh2)nc2h4n+h2

Полиэтиленимин-

PEI-

-CH2-C6H4 -N+H3

Парааминобензил-

PAB-

77

78 Гель-фильтрация

Гель-фильтрация

Гель-фильтрация используется при фракционировании компонентов клеточных экстрактов достаточно широко, и во многих случаях коэффициент специфичности этой процедуры высок. Однако, для направленного применения гель-фильтрации в биотехнологии опять-таки необходимо располагать дополнительной информацией - на этот раз о размерах частиц целевого продукта

78

79 Аффинная хроматография

Аффинная хроматография

Аффинная хроматография характеризуется наиболее высокими коэффициентами специфичности. Используемые сорбенты относятся к двум большим группам. Сорбенты первой группы в качестве аффинных лигандов включают присоединенные к нерастворимому носителю субстраты или ингибиторы ферментов. Сюда же можно отнести и иммуносорбенты, представляющие собой иммобилизованные антитела к целевому продукту или его фрагментам. Принципы конструирования таких сорбентов достаточно просты и понятны. Следует отметить, что сорбенты эти обладают относительно узкой специфичностью и, следовательно, для каждого продукта необходимо конструировать свой сорбент. Это может приводить к удорожанию как технологического процесса, так и продукта.

79

80 Аффинная хроматография

Аффинная хроматография

Ко второй группе аффинных сорбентов относятся материалы, содержащие в качестве лигандов далекие по строению от субстратов и кофакторов ферментов и вообще от природных лигандов белков группировки, с которыми, тем не менее, эти белки связываются достаточно прочно и селективно. Соответствующие соединения зачастую оказываются сильными ингибиторами ферментов. Среди таких сорбентов в течение последнего десятилетия получили распространение иммобилизованные (обычно на полисахаридных матрицах) красители. Известны примеры, когда за одну стадию сорбции и элюции достигается очистка почти в 1 500 раз практически без потерь активности.

80

81 Аффинная хроматография

Аффинная хроматография

Ферменты, связывающиеся с нуклеотидами, имеют повышенное сродство к триазиновым красителям, которые и используются в качестве аффинных лигандов.

81

82 Аффинная хроматография

Аффинная хроматография

В качестве матриц для синтеза аффинных сорбентов используются нейтральные полимеры, чаще всего полисахариды. Некоторые требования к матрицам сформулированы Поратом: - нерастворимость в воде; - достаточная проницаемость и большая удельная поверхность; - высокая жесткость и подходящая форма частиц; - нулевая (или минимальная) сорбционная ёмкость; - химическая стабильность в условиях присоединения лиганда, осуществления хроматографии и регенерации; - устойчивость к микробной и ферментативной деградации; - гидрофильность.

82

83 Аффинная хроматография

Аффинная хроматография

Б)

А)

Основные типы полисахаридных носителей для синтеза аффинных сорбентов: А) декстран; Б) целлюлоза; В) агароза Те же носители могут использоваться для синтеза ионообменников, молекулярных сит и других сорбентов

В)

83

84 Аффинная хроматография

Аффинная хроматография

Использование технологий конструирования рекомбинантных белков позволило встраивать в их структуру элементы, облегчающие их последующую эффективную очистку. К таким элементам относятся специальные аминокислотные последовательности (“тэги”- tags) на концах полипептидной цепи белка, повышающие сродство к определенным лигандам, присоединенным к матрицам – аффинным сорбентам. Одним из наиболее распространенных фрагментов являются последовательности, богатые остатками гистидина. Эта аминокислота за счет имидазольного цикла хорошо и достаточно прочно связывается с сорбентами, содержащими ионы Ni2+ или Co2+.

84

85 Аффинная хроматография

Аффинная хроматография

Целевой продукт с высокой специфичностью извлекается таким сорбентом из клеточного экстракта, выделяется в чистом виде. “Зацепка” может не сказываться на функции белка. В некоторых случаях она оказывается нежелательной, и тогда ее можно удалять с помощью специальной ферментной системы, в частности, разработанной компанией “Novozym”.

85

86 Аффинная хроматография

Аффинная хроматография

В качестве “зацепки” используется богатый гистидином пептид MKHQHQHQHQ, присоединяемый к N-концу целевого белка. После выделения целевого белка “зацепка” удаляется обработкой дипептидиламинопептидазой. Если последовательность целевого белка оказывается неустойчивой к действию этого фермента, “зацепка” дополняется еще одним остатком Q, который далее превращается в пироглутамат-ный остаток (с помощью глутаминциклазы), а затем удаляется пироглутамил-аминопептидазой; в итоге получается нативный целевой белок.

А)

Б)

Pedersen J., Lauritzen C., Madsen M.T., Dahl S.W. Protein Expression and Purification 1999. Vol. 15. P. 389–400.

86

87 Аффинная хроматография

Аффинная хроматография

Помимо гистидиновых тэгов используются и другие пептидные фрагменты:

«Якорная группа»

Размер (а. к.)

Последовательность

Размер (kDa)

Поли-Arg

5–6 (обычно 5)

RRRRR

0.80

Поли-His

2–10 (обычно 6)

HHHHHH

0.84

FLAG

8

DYKDDDDK

1.01

Strep-tag II

8

WSHPQFEK

1.06

c-myc

11

EQKLISEEDL

1.20

S-пептид РНКазы А

15

KETAAAKFERQHMDS

1.75

HAT

19

KDHLIHNVHKEFHAHAHNK

2.31

3x FLAG

22

DYKDHDGDYKDHDIDYKDDDDK

2.73

87

88 Аффинная хроматография

Аффинная хроматография

«Якорная группа»

Размер (а. к.)

Последовательность

Размер (kDa)

Калмодулин-связывающий пептид

26

KRRWKKNFIAVSAANRFKKISSSGAL

2.96

Целлюлозо-связывающие домены

27–189

Домены

3.00-20.00

SBP

38

MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP

4.03

Хитин-связывающий домен

51

TNPGVSAWQVNTAYTAGQLVTYNGKTYKCLQPHTSLAGWEPSNVPALWQLQ

5.59

88

89 Матрицы и условия элюции для различных аффинных фрагментов

Матрицы и условия элюции для различных аффинных фрагментов

Аффинный фрагмент

Матрица

Условия элюции

Poly-Arg

Катионообменная смола

Линейный градиент NaCl (0 to 400 mM), pH>8.0

Poly-His Ni2+ -NTA

Co2+-CMA (Talon)

Имидазол 20-250 mM или низкий pH

FLAG

анти-FLAG моноклональные АТ

pH 3.0 or 2-5 mM EDTA

Strep-tag (AWRHPQFGG)

Strep-tactin (модифицированный стрептавидин)

2.5 mm дестиобиотин

c-myc (EQKLLSEEDLN)

Мат

Низкий ph

S

S-фрагмент РНКазы А

3 M гуанидинизотиоцианат, 0.2 M цитрат, ph 2, 3 M mgcl2

HAT (природный гистидиновый фрагмент)

Co2+ -CMA (Talon)

150 mm имидазол или низкий ph

89

90 Матрицы и условия элюции для различных аффинных фрагментов

Матрицы и условия элюции для различных аффинных фрагментов

Аффинный фрагмент

Матрица

Условия элюции

Калмодулин- связывающий пептид

Калмодулин

EGTA или EGTA с 1 M nacl

Целлюлозо-связывающий домен

Целлюлоза

Семейство I: гуанидин HCl или мочевина >4 M; Семейства II/III: этиленгликоль

SBP

Стрептавидин

2 mm биотин

Хитинсвязывающий домен

Хитин

Фьюз с интеином: 30-50 mM дитиотреит, ?-меркапто-этанол или цистеин

Глутатион S-трансфераза

Глутатион

5-10 mm восстановленный глутатион

Мальтозосвязываю-щий белок

Поперечно сшитая амилоза

10 mm мальтоза

90

91 Интеиновые конструкции

Интеиновые конструкции

В 1990 г. в группе Анраку при исследовании структуры гена ?-субъединицы мембранной АТФазы пекарских дрожжей было обнаружено, что N- и C-концевые участки гена гомологичны известным генам других организмов, в то время как центральная часть гена такой гомологии не проявляет. Этот фрагмент гена АТФ-азы весьма близок по первичной структуре гену НО дрожжей, кодирующему эндонуклеазу. Ген не содержал интронов. Авторы предложили гипотезу о новом типе посттрансляционного процессинга белков, в ходе которого происходит белковый сплайсинг: внутренние фрагменты продукта трансляции, названные впоследствии «интеинами», выщепляют себя из полипептидной цепи с одновременным соединением концевых фрагментов «экстеинов» и образованием конечного белкового продукта. R. Hirata, Y. Ohsumi, A. Nakano, H. Kawasaki, K. Suzuki, Y. Anraku. Molecular structure of a gene, VMA1, encoding the catalytic subunit of H+-translocating adenosine triphosphatase from vacuolar membranes of Saccharomyces cerevisiae//J. Biol. Chem. Vol. 265, No. 12, pp. 6726-6733,1990

91

92 Интеиновые конструкции

Интеиновые конструкции

Схема образования функционально активного белка в процессе белкового сплайсинга

Блок-схема интеиновой структуры.

92

93 Интеиновые конструкции

Интеиновые конструкции

Некоторые аминокислоты в домене сплайсинга высококонсервативны. Первая аминокислота N-концевого интеина (А) и С-концевого экстеина – серин, цистеин или треонин, хотя встречаются и остатки аланина в N-позиции сайта сплайсинга. Аминокислота на С-конце интеина (блок G) – чаще всего аспарагин, предшествует ему гистидин. И, наконец, в блоке N-концевой части интеина обычно присутствует последовательность Thr-x-x-His. Эти аминокислоты играют специфическую роль в структуре интеина и механизме белкового сплайсинга.

93

94 Интеиновые конструкции

Интеиновые конструкции

Четыре независимых стадии внутримолекулярных реакции. Первые три катализирует сам интеин по единственному сайту. Финальная стадия – спонтанная перегруппировка с образованием нормальной пептидной связи. N-X-ацильная миграция: нуклеофильная атака первого остатка интеина, консервативной аминокислоты cys/ser, на соседний карбонильный углерод экстеина Переэтерификация: консервативный остаток cys/ser/thr на N-конце С-экстеина в продукте 1 атакует вновь образованную сложноэфирную группу в сайте сплайсинга Циклизация аспарагина. Амидная группировка боковой цепи аспарагина на С-конце узла сплайсинга атакует собственный карбонильный углерод .Остаток аспарагина циклизуется с образованием С-концевого аминосукцинимида Миграция ацильного остатка от кислорода к азоту с образованием нормальной амидной (пептидной) связи Экстеин в виде функционально активного белка

94

95 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Несмотря на большое разнообразие хроматографических методов по принципам разделения большинство процессов удается организовать в сходной аппаратуре. Основными элементами аппаратурного оформления хроматографического процесса являются: Хроматографическая колонна; Резервуар с элюентом; Насос для подачи элюента; Детектирующее устройство для регистрации выхода с колонки компонентов разделяемой смеси; Коллектор фракций.

95

96 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Несмотря на большое разнообразие хроматографических методов по принципам разделения большинство процессов удается организовать в сходной аппаратуре. Основными элементами аппаратурного оформления хроматографического процесса являются: Хроматографическая колонна; Резервуар с элюентом; Насос для подачи элюента; Детектирующее устройство для регистрации выхода с колонки компонентов разделяемой смеси; Коллектор фракций.

96

97 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Система градиентной элюции

Аппаратурная схема установки для хроматографии: 1 – слой сорбента; 2,3 – устройства ввода элюента и вывода элюата соответственно; 4 – рубашка для термостатирования колонки; 5 – смеситель; 6 – резервуар.

Схема установки выглядит следующим образом: Процесс разделения происходит на колонке с сорбентом 1, куда сверху наносится разделяемая смесь; Для поддержания оптимальной для разделения температуры колонка снабжена рубашкой 4; Раствор элюента подается из сосуда 5 (смеситель), а в сосуде 6 (резервуар) также содержится элюент в концентрации, которая должна обеспечивать полное вытеснение с колонки всех компонентов смеси. За счет последовательного соединения смесителя и резервуара в смесителе концентрация элюента постепенно меняется, так что компоненты смеси вытесняются с колонки постепенно – в зависимости от прочности их связывания с сорбентом.

97

98 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Ход изменения концентрации элюента задается формой и соотношением размеров смесителя и резервуара, начальными концентрациями элюента в смесителе и резервуаре и может быть рассчитан.

Пусть в некоторый момент концентрация элюирующего агента в смесителе равна C (исходная концентрация C0). Пусть сосуды являются цилиндрическими, но имеют различные радиусы и соответственно площади поперечного сечения (S1 и S2).

98

99 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Представим себе ход процесса в следующем виде. Из смесителя, временно разобщенного с резервуаром, на колонку подается порция раствора с концентрацией элюента C. Уровень жидкости в смесителе понижается на величину ?h1. При этом объем вытекающей жидкости равен V = S1?h1. Затем подача раствора на колонку временно прекращается и восстанавливается сообщение смесителя с резервуаром. Часть жидкости из резервуара (с концентрацией C1) перетекает в смеситель до выравнивания уровня в обоих сосудах. Общее понижение уровня составит величину ?h. Обратим внимание на то, что ?h и ?h1 < 0, а ?h < ?h1. Объем жидкости, перешедшей из резервуара в смеситель, будет равен S2?h.

99

100 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Очевидно, что

Попытаемся рассчитать изменение концентрации ?C элюирующего агента в смесителе после описанных событий.

100

101 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Объём жидкости в смесителе будет равен S1(h – ?h). Из смесителя на колонку ушло количество вещества, равное

Из резервуара в смеситель поступило количество вещества, равное Разница между этими количествами вещества, отнесенная к объему жидкости в смесителе, есть изменение концентрации элюирующего агента в смесителе.

101

102 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Помня о знаке ?h, получаем: Переходя от конечных разностей к дифференциалам и отбрасывая слагаемое dhdC как бесконечно малую величину второго порядка малости, получаем:

102

103 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Интегрируя в соответствующих пределах, получаем:

Полученное уравнение позволяет рассчитать ход изменения концентрации элюирующего агента в смесителе по мере прокачивания раствора через хроматографическую колонку (в зависимости от соотношения диаметров смесителя и резервуара).

103

104 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Рассмотренные выше системы смеситель/резервуар основаны на принципе сообщающихся сосудов и поэтому называются равноуровенными. Однако в практике используют и другой тип этих систем – герметично закрытый сосуд с перемешиванием (смеситель), в который поступает раствор элюента конечной концентрации из резервуара. В этом случае объем раствора в смесителе остается постоянным в течение всего процесса элюции, точнее до тех пор, пока в резервуаре еще остается элюент. При этом форма смесителя никакой роли в создании формы градиента не играет.

104

105 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Концентрация раствора элюента в смесителе С, резервуаре – С1. Раствор с помощью насоса подается на колонку, смеситель закрыт герметично, объем жидкости в смесителе постоянный.

105

106 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Рассмотрим, каким законом определяется изменение концентрации элюента в таком смесителе. Если из смесителя вышло количество вещества CdV, то за это же время в смеситель из резервуара перетекло количество вещества CedV (Се – концентрация элюента в резервуаре). Изменение количества вещества в смесителе можно, таким образом, записать в следующем виде: CedV - CdV = VmdC , где Vm – объем смесителя.

106

107 Аппаратурное оформление хроматографических процессов

Аппаратурное оформление хроматографических процессов

Такой градиент называется экспоненциальным.

Из этого соотношения получаем: Начальные условия для интегрирования этого уравнения: при V = 0 (элюент из смесителя еще не вытекал на колонку) C = C0 (начальная концентрация элюента в смесителе). Интегрируя уравнение с учетом этих начальных условий, получаем

107

108 Препаративные хроматографические колонны

Препаративные хроматографические колонны

Препаративные хроматографические колонны

108

109 Препаративные хроматографические колонны

Препаративные хроматографические колонны

Препаративные хроматографические колонны

109

110 Хроматография с симуляцией подвижного слоя сорбента

Хроматография с симуляцией подвижного слоя сорбента

Принцип хроматографии с симуляцией подвижного слоя сорбента Черепаха и котенок бегут по полотну транспортера, лента которого движется им навстречу. Скорость ленты меньше, чем скорость котенка, но больше, чем скорость черепахи. Котенок оказывается впереди транспортера, черепаха отбрасывается назад.

110

111 Хроматография с симуляцией подвижного слоя сорбента

Хроматография с симуляцией подвижного слоя сорбента

Хроматографическая колонка с непрерывной подачей разделяемой смеси и элюента. Разделяемая смесь подается в центр колонки, растворитель движется слева направо, сорбент перемещается справа налево. Смесь разделяется: быстро движущийся компонент (с малым временем удерживания) оказывается в «раффинате», компонент с большим временем удерживания – в «экстракте».

111

112 Хроматография с симуляцией подвижного слоя сорбента

Хроматография с симуляцией подвижного слоя сорбента

Четырехсекционная система хроматографических колонок с непрерывной подачей разделяемой смеси и элюента. Разделяемая смесь подается в центр системы, растворитель и сорбент движутся в противоположных направлениях. Разделение компонентов А и В происходит в секциях 2 и 3, секция 1 регенерирует сорбент, секция 4 – очищает растворитель.

112

113 Хроматография с симуляцией подвижного слоя сорбента

Хроматография с симуляцией подвижного слоя сорбента

Схема производственной установки для хроматографии с симуляцией подвижного слоя: Четырехсекционная система с изменением функции портов ввода. Подача разделяемой смеси осуществляется в левый нижний порт, через определенное время происходит переключение так, что смесь подается в левый верхний порт и так далее. Синхронно переключаются и порты подачи растворителя, вывода раффината и экстракта. В итоге разделение упрощается и ускоряется. Симуляция подвижного слоя сорбента достигается переключением портов.

113

114 Мембранные технологии

Мембранные технологии

Ранее мы рассматривали процесс фильтрации как способ стерилизации питательных сред, а также разделения суспензий. По сути, процесс заключается в том, что на пути потока суспензии устанавливается полупроницаемая перегородка - фильтр, через которую свободно проникает дисперсионная среда - жидкость или газ - и не проникает дисперсная фаза - пыль, частицы осадка и т.п.

114

115 Мембранные технологии

Мембранные технологии

Простейшими материалами, используемыми для приготовления полупроницаемых перегородок являются ткани, специальные сорта бумаги, слои волокнистых материалов (вата, асбест, стекловолокно), которые задерживают достаточно крупные частицы дисперсной фазы. Однако с прогрессом науки и технологии появились материалы, способные задерживать все более мелкие частицы и даже относительно крупные молекулы.

115

116 Мембранные технологии

Мембранные технологии

В итоге сформировался специальный раздел техники фракционирования сложных смесей - мембранные технологии. С их помощью появляется возможность не только разделять суспензии, но и фракционировать смеси белков по размерам молекул, концентрировать белковые фракции различного молекулярного веса, производить обессоливание воды и т.п.

116

117 Мембранные технологии

Мембранные технологии

Технология

ПРЕДЕЛЫ, мкм

Примеры объектов

Области применения

Диализ, обратный осмос

5•10-4 -5 •10-2

Аминокислоты, сахара, прочие низкомолекулярные метаболиты

Обессоливание воды, очистка низкомоле-кулярных продуктов

Ультрафильтрация

5 •10-3-5•10-1

Биополимеры вирусы, рибосомы, мелкие бактерии

Очистка биополи-меров, стерилизация питательных сред и продуктов

Микрофильтрация

10-1 – 10

Крупные бактерии, микроскопические грибы, культивируе-мые эукариотические клетки

Удаление мелких частиц примесей, предварительная стерилизация

Обычная фильтрация

>1,0 мкм

Механические частицы, пыльца растений

Удаление механи-ческих примесей

117

118 Мембранные технологии

Мембранные технологии

В нашем случае системы раствор - растворитель, разделенной полупроницаемой перегородкой так, что по одну сторону этой перегородки находится раствор, а по другую - растворитель, причем через эту перегородку может проникать только растворитель, возникает следующая ситуация. Слева от перегородки, где находится чистый растворитель, его мольная доля х = 1, и, следовательно, его химический потенциал ?L = ?o. Справа от перегородки – раствор, химический потенциал растворителя ?R равен ?R =? o + RTlnx, где RTln x < 0 (х < 1). ?L >?R – химический потенциал растворителя справа меньше, чем слева.

118

119 Мембранные технологии

Мембранные технологии

При р>? возникает поток растворителя из части системы с более концентрированным раствором в часть системы с менее концентрированным раствором. Это явление называют обратным осмосом. Растворенное вещество при этом остается там, где его концентрация выше. Технология используется для концентрирования растворов, в том числе для обессоливания растворителя, в частности – для опреснения морской воды.

119

120 Мембранные технологии

Мембранные технологии

Возникшая разность химических потенциалов тем выше, чем ниже х, то есть чем выше концентрация раствора. Под влиянием этой разности возникает поток растворителя в раствор через полупроницаемую перегородку, и интенсивность этого потока тем выше, чем выше концентрация растворенного вещества. Это явление получило название осмос. Молекулы растворителя могут переходить и в обратном направлении, однако преимущественным направлением переноса является перенос растворителя из части с б?льшим химическим потенциалом в часть с меньшим его значением.

120

121 Мембранные технологии

Мембранные технологии

На практике при использовании мембранных технологий встречаются некоторые осложнения. Одним из таковых является «концентрационная поляризация» мембраны – явление аналогичное концентрационной поляризации фильтров. Если давление направлено перпендикулярно поверхности мембраны, то в приповерхностном слое жидкости возникает локальное повышение концентрации растворенного вещества. Это приводит к повышению сопротивления мембраны, которое приходится компенсировать повышением избыточного давления. Преодолеть эту ситуацию можно путем либо разрушением приповерхностного слоя, либо предотвращения его образования. Первая задача решается посредством эффективного перемешивания раствора, вторая - путем проведения процесса в циркуляционном режиме с тангенциальным потоком жидкости по отношению к поверхности мембраны.

121

122 Мембранные технологии

Мембранные технологии

Направление фильтрации (?) перпендикулярно направлению потока (?) Поток раствора продукта смывает слой концентрационной поляризации мембраны, вихри Тейлора усиливают массообмен

Исходный продукт

Концентрат

Вихри Тейлора

Фильтрат

122

123 Мембранные технологии

Мембранные технологии

В последние годы интенсивно разрабатывается технология препаративной очистки различных продуктов биосинтеза с использованием ионообменных или содержащих аффинные лиганды мембран (мембранная хроматография). Применение мембранной хроматографии позволяет обеспечить высокую производительность по потоку в сочетании с высокой селективностью. Повышенная по сравнению с гранульными хроматографическими материалами производительность по потоку у мембранных адсорберов достигается за счет снятия диффузионных ограничений для разделяемых компонентов. В типичном эксперименте за одну стадию на адсорбере с поверхностью мембраны 16 м2 и продолжительностью цикла 7 мин может быть очищено 60 г гемоглобина из бычьей крови. Gottschalk U., Fischer-Freuhholz S., Reif O. Membrane Adsorbers. A Cutting Edge Process Technology at the Threshold // BioProcess International. 2004. Vol. 2. No.5. P. 56-65. http://www.bioprocessintl.com/

123

124 Концентрирование

Концентрирование

Другим способом удаления влаги является распылитель-ная сушка. Раствор продукта подается в форсунку, через которую распыляется в противоположно направлен-ный поток горячего воздуха. Мелкие капли раствора быстро испаряются, продукт при этом нагревается мало за счет отдачи тепла на испарение, термо-инактивации не происходит. Имеет место унос продукта током воздуха, необходимо улавливание

124

125 Концентрирование

Концентрирование

Для особо чувствительных к температуре продуктов применяется лиофильная сушка - сушка вымораживанием. Раствор продукта замораживается и помещается в вакуумную камеру, в которой происходит возгонка льда. Переход льда в газовую фазу сопровождается сильным отводом тепла и охлаждением продукта в процессе высушивания. Процедура весьма дорогая, используется лишь при производстве препаратов медицинского назначения, специальная высоко автоматизированная аппаратура позволяет осуществлять процесс в стерильных условиях, продукт после выгрузки оказывается в состоянии, готовом к контролю и реализации.

125

126 Товарная форма продукта

Товарная форма продукта

Готовая форма продукта – сложная композиция. Состав готовой формы определяется основными требованиями к товарному продукту: Обеспечение сохранности активности действующего начала продукта в процессе хранения; Обеспечение возможности проявления активности действующего начала в процессе применения.

126

127 Товарная форма продукта

Товарная форма продукта

Полный состав готовой формы называют РЕЦЕПТУРОЙ. Рецептура товарной формы продукта включает помимо действующего начала соответствующие компоненты и наполнители.

127

128 Товарная форма продукта

Товарная форма продукта

Для продуктов, предназначенных для длительного хранения в крупных фасовках, в качестве наполнителя в составе товарной формы должны присутствовать компоненты, препятствующие слеживанию продукта. Для продуктов, предназначенных для применения в виде распыляемых порошков или растворов (микробиологические средства защиты растений и т.п.) в состав рецептур вводят компоненты, обеспечивающие смачивание поверхности, на которой продукт должен находиться для проявления своих свойств (например, поверхностно активные вещества). Для ферментных и других белковых препаратов в качестве наполнителей используются компоненты, стабилизирующие белковые вещества по отношению к внешним воздействиям.

128

129 Товарная форма продукта

Товарная форма продукта

В рецептуру товарного продукта, предназначенного для введения в организм как лекарственного средства, в качестве дополнительных компонентов могут быть введены также вещества, защищающие действующее начало от воздействия сред организма по пути к месту действия. Во всех случаях компоненты рецептуры НЕ ДОЛЖНЫ НАНОСИТЬ УЩЕРБ ОКРУЖАЮЩЕЙ СРЕДЕ.

129

130 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

Как биотехнологическая продукция, так и процесс ее производства подвергаются строгому контролю качества. Наиболее строгий контроль за качеством продукции осуществляется при производстве лекарственных средств и их компонентов. Для оказания помощи органам здравоохранения импортирующих стран в оценке технического уровня производства и качества закупаемых ими лекарственных средств создана «Система удостоверения качества фармацевтических препаратов в международной торговле» - особый вид многостороннего международного соглашения.

130

131 Впервые эта система введена в действие Всемирной организацией

Впервые эта система введена в действие Всемирной организацией

здравоохранения (ВОЗ, WHO – World Health Organization) в 1969 г. Действующий в настоящее время вариант системы принят в 1975 г. В настоящее время к системе присоединилось более 80 государств.

Организация производственного процесса и контроля качества продукции в биотехнологии

131

132 Для участия в системе необходимо наличие в стране трех условий: 1)

Для участия в системе необходимо наличие в стране трех условий: 1)

государственная система регистрации лекарственных средств; 2) государственное инспектирование фармацевтических предприятий; 3) наличие правил GMP (Good Manufacturing Practices –Правил правильного производства).

Организация производственного процесса и контроля качества продукции в биотехнологии

132

133 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

GMP – единая система требований к организации производства и контролю качества лекарственных средств от начала переработки сырья до получения готовых продуктов. Существуют национальные Правила GMP, региональные (Правила стран Европейского Экономического Сообщества, Правила стран-участников «Соглашения по фармацевтическому контролю» – Pharmaceutical Inspection Convention, PIC, Правила стран-членов Ассоциации стран Юго-Восточной Азии) и международные правила GMP – Правила Всемирной организации здравоохранения.

133

134 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

В России действует НАЦИОНАЛЬНЫЙ СТАНДАРТ РОССИЙСКОЙ ФЕДЕРАЦИИ «ПРАВИЛА ПРОИЗВОДСТВА И КОНТРОЛЯ КАЧЕСТВА ЛЕКАРСТВЕННЫХ СРЕДСТВ» (ГОСТ Р 52249-2009), утвержденный Приказом Федерального агентства по техническому регулированию и метрологии от 20 мая 2009 г №159ст. Дата введения 01.01 2010. Этот документ обязателен для всех предприятий, выпускающих готовые лекарственные средства медицинского назначения и лекарственные вещества, предназначенные для изготовления готовых лекарственных средств.

134

135 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

Правила включают в себя следующие разделы: Определения; Управление качеством; Персонал; Здания и помещения; Оборудование; Процесс производства; Валидация; Рекламации и отзыв продукта с рынка; Самоинспекция .

135

136 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

Раздел «Определения» определяет толкование терминов, используемых в производственной лексике. Примеры определения терминов: Предприятие - производитель лекарственных средств - организация, осуществляющая производство лекарственных средств в соответствии с требованиями Федерального закона "О лекарственных средствах". Лекарственные средства - вещества, применяемые для профилактики, диагностики, лечения болезни, предотвращения беременности, полученные из крови, плазмы крови, а также органов, тканей человека или животного, растений, микроорганизмов, минералов, методами синтеза или с применениям биологических технологий. К лекарственным средствам относятся также вещества растительного, животного или синтетического происхождения, обладающие фармакологической активностью и предназначенные для производства и изготовления лекарственных средств. Лекарственные препараты - дозированные лекарственные средства, готовые к применению. Качество лекарственных средств - соответствие лекарственных средств государственному стандарту качества лекарственных средств.

136

137 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

Раздел «Управление качеством» определяет комплекс мероприятий, обеспечивающих качество выпускаемой продукции. При этом должны учитываться требования GLP (Good Laboratory Practices – Правила доклинической оценки безопасности фармакологических средств), GCP (Good Clinical Practices – Правил проведения клинических испытаний) и GMP. Здесь же устанавливается ответственность предприятия за качество выпускаемых лекарственных средств.

137

138 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

Раздел «Персонал» устанавливает требования к персоналу, занятому в процессе организации производства и контроля качества выпускаемой продукции, порядок и направления подготовки персонала и правила личной гигиены персонала, включая требования об обязательном прохождении медицинского осмотра, требования к состоянию здоровья и порядок приема пищи, ее хранения (запреты принимать пищу, курить и хранить еду, курительные материалы и личные лекарства в производственных помещениях и на складах готовой продукции). Отдельно устанавливаются обязанности персонала «чистых помещений», в числе которых ограничение входа и выхода в «чистые» помещения и требование разработки специальных инструкций. Производственный процесс в «чистых» помещениях должен осуществляться минимальным количеством персонала с ограничением проведения в этих помещениях инспекционных мероприятий и контрольных процедур. Здесь же устанавливаются требования к уровню квалификации персонала и определяется порядок повышения квалификации и профессиональной переподготовки персонала, в том числе и руководящего звена.

138

139 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

Раздел «Здания и помещения» содержит описание конструктивных особенностей зданий и сооружений, входящих в комплекс фармацевтического предприятия, требования к размещению фармацевтических предприятий относительно жилых зон и других производств, отрицательно влияющих на качество продукции. Производственные здания должны быть спроектированы и построены так, чтобы свести к минимуму запыление, загрязнение и исключить проникновение в них насекомых и животных. В разделе устанавливаются общие требования к планировке производственных зданий и к их инженерному оснащению, нормы по допустимому содержанию в воздухе производственных помещений микроорганизмов и механических частиц. К помещениям для производства стерильных лекарственных средств предъявляются повышенные требования к их чистоте.

139

140 Классификация помещений производства лекарственных средств

Классификация помещений производства лекарственных средств

Максимально допустимое количество частиц в 1 м3 воздуха размером, мкм

Максимально допустимое количество частиц в 1 м3 воздуха размером, мкм

Максимально допустимое количество частиц в 1 м3 воздуха размером, мкм

Максимально допустимое количество частиц в 1 м3 воздуха размером, мкм

А

В

С

D

Класс чистоты помещений или зон

Класс чистоты помещений или зон

Класс чистоты помещений или зон

Макс. допустимое кол-во жиз-неспособных микроорга-низмов в 1 м3 воздуха

Макс. допустимое кол-во жиз-неспособных микроорга-низмов в 1 м3 воздуха

? 0,5

? 5

? 0,5

? 5

Оснащенное состояние

Оснащенное состояние

Функционирующее состояние

Функционирующее состояние

Функционирующее состояние

3500

0

3500

0

Менее 1

3500

0

350000

2000

10

350000

2000

3500000

20000

100

500000

20000

Не определено

Не определено

200-500

140

141 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

Раздел «Оборудование» устанавливает требования к оборудованию, используемому в производственном процессе. Эти требования направлены на то, чтобы конструкция и размещение оборудования максимально облегчали его подготовку к работе, эксплуатацию и обслуживание. - поверхности оборудования должны быть гладкими и изготовленными из стойкого к коррозии материала, который выдерживает обработку дезинфицирующими средствами и/или стерилизацию; - все детали оборудования, контактирующие с используемыми сырьем, материалами и полупродуктами, должны быть съемными для облегчения их мойки, обработки дезинфицирующими средствами или стерилизации; Оборудование должно быть размещено таким образом, чтобы: - оптимизировать потоки исходного сырья, материалов; - предотвратить возможность загрязнения лекарственных средств в процессе их производства; - предотвратить риск смешивания разных продуктов или исключения какой - либо из стадий производственного процесса; - облегчить мойку, обработку, эксплуатацию и обслуживание оборудования. Для работы в "чистых" помещениях оборудование, по возможности, должно быть сконструировано и размещено таким образом, чтобы его эксплуатацию, обслуживание и ремонт можно было проводить за пределами "чистых" помещений. Для работы в асептических условиях оборудование должно иметь регистрирующие устройства для контроля параметров процесса и обеспечено устройствами сигнализации, извещающими о неисправности.

141

142 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

Раздел «Процесс производства» устанавливает требования к исходному сырью, его хранению и подготовке, подготовке и использованию материалов первичной упаковки, к собственно производственному процессу, маркировке и вторичной упаковке, хранению готового продукта, обращению с остатками продукта, возвращению и переработке брака, контролю процесса производства, порядку регистрации процессов производства и контроля. Неотъемлемой частью системы обеспечения качества готовых продуктов является составленная надлежащим образом документация. Основными документами, которые должны использоваться в процессе производства, являются: технологические регламенты; инструкции; производственные регистрационные записи; аналитические методики, спецификации качества и другие стандарты предприятия. Операции технологического процесса должны выполняться и контроли-роваться квалифицированным персоналом с использованием необхо- димого оборудования и приборов в специально предназначенных для этих целей помещениях. С целью предотвращения выпуска готового продукта, не соответствую-щего требованиям нормативной документации, должен проводиться постадийный контроль процесса производства.

142

143 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

Валидация заключается в документированном подтверждении соответствия оборудования, условий производства, технологического процесса, качества полупродукта и готового продукта действующим регламентам и/или требованиям нормативной документации. Основными элементами валидации являются: - оценка монтажа и работоспособности основного технологического и вспомогательного оборудования, в том числе компьютерных систем; - оценка условий и параметров технологического процесса; - оценка предела возможного отклонения в ведении процесса; - оценка методов анализа; - составление протоколов и отчета, аттестующих технологический процесс.

143

144 Организация производственного процесса и контроля качества продукции в

Организация производственного процесса и контроля качества продукции в

биотехнологии

РЕКЛАМАЦИИ И ОТЗЫВ ПРОДУКТОВ С РЫНКА На предприятии должен быть определен сотрудник, ответственный за рассмотрение рекламаций и принимающий решение о подлежащих осуществлению мероприятиях. Он должен иметь возможность привлекать к работе необходимое количество сотрудников. Если этот сотрудник не является руководящим сотрудником или ответственным специалистом, то он должен довести до сведения последних каждую рекламацию, ход ее расследования или отзыв с рынка лекарственных веществ или готовых лекарственных средств. На предприятии должен быть определен сотрудник, ответственный за сбор и учет отзывов с рынка лекарственных веществ и готовых лекарственных средств. Он имеет возможность привлекать к работе необходимое количество сотрудников для безотлагательного рассмотрения всех аспектов отзыва продуктов с рынка. Этот сотрудник, как правило, независим от руководителя по реализации продукции. Если этот сотрудник не является руководящим сотрудником или ответственным специалистом, то он доводит до сведения последних информацию о каждом случае отзыва продукта с рынка. Осуществление отзыва продукта с рынка должно быть зафиксировано и отражено в соответствующих производственных регистрационных записях. Отчет и производственные регистрационные записи должны быть включены в досье на препарат.

144

145 САМОИНСПЕКЦИЯ Целью самоинспекции является оценка производителем

САМОИНСПЕКЦИЯ Целью самоинспекции является оценка производителем

соответствия его фармацевтического производства всем аспектам Правил. Программа проведения самоинспекции должна быть поставлена таким образом, чтобы выявить любые недостатки в выполнении Правил и рекомендовать мероприятия, необходимые для их устранения. Самоинспекция должна проводиться по плану и, кроме того, может быть проведена дополнительно, например в случае отзыва продукта с рынка. Проведение самоинспекции должно быть запротоколировано. На предприятии формируется группа по проведению самоинспекции. Членами группы могут быть как сотрудники предприятия, являющиеся высококвалифицированными специалистами в своей области и хорошо знающие Правила, так и независимые эксперты.

Организация производственного процесса и контроля качества продукции в биотехнологии

145

«Биотехнология»
http://900igr.net/prezentacija/biologija/biotekhnologija-151574.html
cсылка на страницу

Генная инженерия

3 презентации о генной инженерии
Урок

Биология

136 тем
Слайды