Научное исследование
<<  Школьное научное общество «ИСТОК» За 8 класс на охрана матерей  >>
Основные результаты научной и научно-организационной деятельности
Основные результаты научной и научно-организационной деятельности
История ТИБОХ ДВО РАН
История ТИБОХ ДВО РАН
Численность
Численность
Возрастной состав научных сотрудников Института
Возрастной состав научных сотрудников Института
Основные научные направления Института
Основные научные направления Института
Тематика работ Института 2009-2010 гг
Тематика работ Института 2009-2010 гг
6
6
Гранты Института
Гранты Института
Некоторые результаты исследований Института в 2006-2010 гг
Некоторые результаты исследований Института в 2006-2010 гг
Новые метаболиты и их свойства
Новые метаболиты и их свойства
Первый ингибитор ванилоидного болевого рецептора из актинии Heteractis
Первый ингибитор ванилоидного болевого рецептора из актинии Heteractis
Новый тип каррагинана из дальневосточных водорослей и полезные
Новый тип каррагинана из дальневосточных водорослей и полезные
Новые природные соединения из высших наземных растений
Новые природные соединения из высших наземных растений
Метаболиты наземных растений
Метаболиты наземных растений
Органический синтез природных соединений
Органический синтез природных соединений
Свойства, специфичность, механизм действия, структура и функция
Свойства, специфичность, механизм действия, структура и функция
Ферменты морских организмов
Ферменты морских организмов
Молекулярная биология и молекулярная генетика
Молекулярная биология и молекулярная генетика
Изучение молекулярных механизмов действия биологически активных
Изучение молекулярных механизмов действия биологически активных
Иммуногенные белки грамотрицательных бактерий
Иммуногенные белки грамотрицательных бактерий
Иммуноферментные (ИФА) тест-системы разработаны для диагностики острых
Иммуноферментные (ИФА) тест-системы разработаны для диагностики острых
Лектины, выделенные из морских беспозвоночных и водорослей –уникальные
Лектины, выделенные из морских беспозвоночных и водорослей –уникальные
Установлена структура О-специфического полисахарида R-формы морской
Установлена структура О-специфического полисахарида R-формы морской
Исследования биоресурсов Таксономия морских микроорганизмов
Исследования биоресурсов Таксономия морских микроорганизмов
Исследования биоресурсов
Исследования биоресурсов
Биоиспытания и фармакология
Биоиспытания и фармакология
Разработан способ выделения полифенольных соединений из морских трав
Разработан способ выделения полифенольных соединений из морских трав
Разработан и согласован ОПЫТНО-ПРОМЫШЛЕННЫЙ РЕГЛАМЕНТ
Разработан и согласован ОПЫТНО-ПРОМЫШЛЕННЫЙ РЕГЛАМЕНТ
Подана заявка в ФГУ «Научный центр экспертизы средств медицинского
Подана заявка в ФГУ «Научный центр экспертизы средств медицинского
Медицинские препараты, ранее разработанные в ТИБОХ
Медицинские препараты, ранее разработанные в ТИБОХ
Инновационная деятельность
Инновационная деятельность
Инновационная деятельность
Инновационная деятельность
Медицинские препараты, разрабатываемые в ТИБОХ
Медицинские препараты, разрабатываемые в ТИБОХ
Публикации Института
Публикации Института
Количественные показатели результатов научной деятельности Института
Количественные показатели результатов научной деятельности Института
Анализ цитируемости публикаций Института
Анализ цитируемости публикаций Института
Цитируемость некоторых научных сотрудников
Цитируемость некоторых научных сотрудников
Место публикаций Института в рейтинге публикаций институтов ДВО РАН
Место публикаций Института в рейтинге публикаций институтов ДВО РАН
Некоторые публикации в научных журналах высокого уровня: Ligand of
Некоторые публикации в научных журналах высокого уровня: Ligand of
Научные и государственные награды
Научные и государственные награды
Правовая защита объектов интеллектуальной собственности
Правовая защита объектов интеллектуальной собственности
Научно-экспериментальная база
Научно-экспериментальная база
Показатели работы аспирантуры
Показатели работы аспирантуры
Международная деятельность
Международная деятельность
Совместные научные исследования с зарубежными партнерами
Совместные научные исследования с зарубежными партнерами
Экспедиции
Экспедиции
Благодарю за внимание
Благодарю за внимание

Презентация: «Основные результаты научной и научно-организационной деятельности Учреждения Российской академии наук Тихоокеанского института биоорганической химии Дальневосточного отделения РАН за период 2006 - 2010 гг». Автор: Stonik V.A.. Файл: «Основные результаты научной и научно-организационной деятельности Учреждения Российской академии наук Тихоокеанского института биоорганической химии Дальневосточного отделения РАН за период 2006 - 2010 гг.ppt». Размер zip-архива: 14860 КБ.

Основные результаты научной и научно-организационной деятельности Учреждения Российской академии наук Тихоокеанского института биоорганической химии Дальневосточного отделения РАН за период 2006 - 2010 гг

содержание презентации «Основные результаты научной и научно-организационной деятельности Учреждения Российской академии наук Тихоокеанского института биоорганической химии Дальневосточного отделения РАН за период 2006 - 2010 гг.ppt»
СлайдТекст
1 Основные результаты научной и научно-организационной деятельности

Основные результаты научной и научно-организационной деятельности

Учреждения Российской академии наук Тихоокеанского института биоорганической химии Дальневосточного отделения РАН за период 2006 - 2010 гг. Акад. В.А. Стоник

2 История ТИБОХ ДВО РАН

История ТИБОХ ДВО РАН

Учреждение РАН Тихоокеанский институт биоорганической химии ДВО РАН создано под названием Институт биологически активных веществ СО АН СССР в марте-апреле 1964 г. на основании Распоряжения Совета министров РСФСР № 4297-р от 03 октября 1963 г. и Постановления Президиума Академии наук СССР № 79 от 06 марта 1964 г. Нынешнее название Институт получил в 1972 г. Институт входит в состав организаций, находящихся в ведении Учреждения Российской академии наук Дальневосточного отделения РАН. Научно-методическое руководство Институтом осуществляет Отделение биологических наук РАН.

3 Численность

Численность

Численность

Численность

Возраст (лет)

Возраст (лет)

Возраст (лет)

Возраст (лет)

Возраст (лет)

Возраст (лет)

Возраст (лет)

До 50 лет - 35,8%, 50-60 лет – 27,7%, 60-70 лет - 27,1%, Более 70 – 9,4%

Всего

Всего

Из них

Из них

До 29

До 29

30 – 39 лет

30 – 39 лет

40 – 49 лет

40 – 49 лет

50 – 59 лет

50 – 59 лет

60 – 69 лет

60 – 69 лет

Старше 70 лет

Старше 70 лет

Старше 70 лет

Старше 70 лет

Муж

Жен.

Всего по штатному расписанию

137

49

49

49

37

51

51

51

Всего научных работников, в том числе:

150

52

98

17

19

17

40

44

44

13

Академики

2

2

-

-

-

-

-

1

1

1

чл.-корр. РАН

2

2

-

-

-

-

-

1

1

1

Доктора наук

24

12

12

-

-

1

9

10

10

4

Кандидаты наук

96

27

69

9

17

9

24

30

30

7

Без ученой степени

26

9

17

8

2

7

6

3

3

-

4 Возрастной состав научных сотрудников Института

Возрастной состав научных сотрудников Института

В зависимости от среднего возраста сотрудников научные подразделения распределяются следующим образом: – до 39 лет – 2 подразделения; – до 49 лет – 8 подразделений; – до 59 лет – 6 подразделений; – > 60 лет – 4 подразделения.

Общее количество сотрудников Количество научных сотрудников Средний возраст сотрудников полной занятости – 51 год

5 Основные научные направления Института

Основные научные направления Института

Институт осуществляет научную деятельность по шести направлениям, утвержденным Постановлением Президиума РАН № 642 от 23.12.2008 г. и закрепленным в новой редакции Устава Института: химические проблемы создания фармакологически активных веществ нового поколения; структура и функции биомолекул и надмолекулярных комплексов; биологическое разнообразие; молекулярная генетика, механизмы реализации генетической информации, биоинженерия; клеточная биология; биотехнология.

6 Тематика работ Института 2009-2010 гг

Тематика работ Института 2009-2010 гг

«Новые фармакологически активные низко- и высокомолекулярные метаболиты морских организмов. Выделение, структуры, синтез, свойства и молекулярный механизм действия» № гос. регистрация 01.2.00 951074. Научный руководитель – академик В.А. Стоник. «Хемотаксономическое исследование перспективных восточноазиатских растений - источников для получения экдистероидов, алкалоидов, полифенолов» № гос. регистрация 01.2.00 951073. Научный руководитель – академик П.Г. Горовой. «Таксономическое и экологическое разнообразие, биотехнологический потенциал гетеротрофных аэробных и факультативно анаэробных морских бактерий и грибов-микромицетов» № гос. регистрация 01.2.00 951068. Научный руководитель – чл.-корр. РАН В.В. Михайлов. «Биотехнологические исследования, направленные на создание новых препаратов для медицины, сельского хозяйства и других отраслей» № гос. регистрация 01.2.00 951072. Научный руководитель – д.х.н. Э.П. Козловская. «Изучение свойств и взаимосвязи между структурой и функцией ключевых для морских организмов ферментов; создание оптимальных генетических конструкций для экспрессии ферментов» № гос. регистрация 01.2.00 951070. Научные руководители – к.б.н. В.А.Рассказов, д.х.н. Т.Н. Звягинцева. «Изучение структуры и биологических свойств макромолекул и их комплексов, включенных в патогенез наиболее распространенных и социально значимых бактериальных инфекций» № гос. регистрация 01.2.00 951069. Научный руководитель – д.х.н. Т.Ф. Соловьева.

7 6

6

6

6

7

7

32

1

1

1

1

1

5

12

10

11

8

8

49

2006

2007

2008

2009

2010

Всего

ТИБОХ ДВО РАН принимал участие в выполнении следующих программ Президиума РАН и Отделения биологических наук РАН:

Виды проектов

Проекты по программам Президиума РАН

Проекты по программам ОБН РАН

Интеграционные проекты с СО и УрО РАН

Программы Президиума РАН 2006–2008 гг. Программа № 21 «Молекулярная и клеточная биология»; Программа № 22 «Фундаментальные науки - медицине». 2009–2010 гг. Программа № 21 «Молекулярная и клеточная биология»; Программа № 22 «Фундаментальные науки - медицине»; Программа № 27 «Основы фундаментальных исследований нанотехнологий и наноматериалов». Программы Отделения биологических наук РАН 2006–2008 гг. Программа «Научные основы сохранения биоразнообразия России»; Программа «Биологические ресурсы России: фундаментальные основы рационального использования». 2009–2010 гг. Программа «Биологическое разнообразие».

8 Гранты Института

Гранты Института

Виды программ

2006

2007

2008

2009

2010

Всего

ФЦП фундаментальных исследований

5

3

3

3

2

16

ФЦП «Кадры России»

1

1

Гранты РФФИ, всего:

22

19

22

15

14

92

Инициативные

9

12

11

12

10

54

РФФИ-региональные

9

5

3

2

2

21

Ориентирован. Фундамент. Исследования

1

1

1

-

-

3

Международные

-

1

1

1

1

4

Организация экспедиций

1

-

-

-

-

1

Организация конференций

-

-

1

-

-

1

Трэвел-гранты

1

-

1

2

Мтб

3

1

3

1

-

8

Гранты Президента РФ (НШ/молод. ученые)

3/2

2/2

1/0

1/1

1/1

8/6

Целевые программы ДВО РАН

-

-

-

-

3

3

Академики П.Г. Горовой, В.А. Стоник и чл.корр. В.В. Михайлов являлись получателями гранта Президента РФ на поддержку ведущих школ. Возглавляемые ими школы входят в число признанных научных школ Дальнего Востока России.

9 Некоторые результаты исследований Института в 2006-2010 гг

Некоторые результаты исследований Института в 2006-2010 гг

Биоорганическая химия

Из морских беспозвоночных, водорослей, бактерий и грибов выделено более 400 индивидуальных соединений, в том числе более 170 новых, для которых установлено химическое строение, включая в ряде случаев абсолютную стереохимию. К ним относятся полярные соединения из морских звезд, тритерпеновые гликозиды из голотурий, липиды, стероидные и тритерпеновые гликозиды из губок, сульфатированные полигидроксистероиды, содержащие уникальные хлор- и иодфурановые фрагменты, дитерпеноиды спонгианы, алкалоиды, макролиды, пептиды и др. Была обнаружена серия соединений, усиливающих дифференцировку нейронов и рост нервных отростков (нейритов). Установлено, что изученные соединения проявляют значительный синергетический эффект при совместной обработке клеток фактором роста нервов (NGF) и этими веществами. Изучаемые соединения являются потенциальными биологическими субстанциями для создания нейротрофных и нейропротекторных препаратов, которые могут быть использованы при лечении нейродегенеративных заболеваний и травм головного и спинного мозга.

Контрольные клетки

Клетки, обработанные линкозидом L1, 7,5 мкМ, 5 дней

10 Новые метаболиты и их свойства

Новые метаболиты и их свойства

Изоризохалин из морской губки

Биоорганическая химия

Новый гексациклический алкалоид монанхоцидин из губки с ранее неизвестной скелетной системой высокотоксичен для опухолевых клеток, стимулирует их программируемую смерть (апоптоз).

Тетрациклический алкалоид ОФИУРОИДИН из офиуры O. rosei – мощный антиоксидант

Vessel part Anchor part

Из губки Rhizochalina incrustata выделен новый двухголовый сфинголипид изоризохалин. Установлена его химическая структура, включая абсолютную стереохимию всех четырех хиральных центров, которая предполагает стереодивергентный биогенез изоризохалина с участием как D-, так и L-аланина.

Необычный ЛИПОПОЛИСАХАРИД из морской ?-протеобактерии L. rosea.

11 Первый ингибитор ванилоидного болевого рецептора из актинии Heteractis

Первый ингибитор ванилоидного болевого рецептора из актинии Heteractis

crispa

Биоорганическая химия

Биологическое действие

Пространственное строение нового ингибитора и близкого к нему ингибитора трипсина

Структура APHC1: GSICLEPKVVGPCTAYFRRFYFDSETGKCTVFIYGGCEGNGNNFETLRACRAICRA

А - Модель тепловой стимуляции боли in vivo, тест «отдергивания хвоста». По оси абсцисс – время, прошедшее после инъекции APHC1 (0.1 мг/кг), по оси ординат – время реакции APHC1 на болевой стимул, n =5. Б, В - Действие APHC1 на TRPV1-рецептор. Аппликация капсаицина и смеси капсаицина с ингибитором TRPV1-рецептора, (А) природным APHC1 (концентрация 500 нM) или (Б) рекомбинантным APHC1 (концентрация 300 нM). Каналы активированы 2 ?M капсаицина в течение 35 сек (А) или 20 сек (Б) до отмывки ооцита, потенциал, приложенный к ооцитам -50 мВ.

12 Новый тип каррагинана из дальневосточных водорослей и полезные

Новый тип каррагинана из дальневосточных водорослей и полезные

свойства этих полисахаридов.

Протективный эффект каррагинанов против действия ЛПС

Биоорганическая химия

540кДа

X-каррагинан

Tichocarpus crinitus

Каррагинан стимулирует рост бифидобактерий. Содержание бифидобактерий в опытном образце с каррагинаном превысило таковое в контрольном образце в 10 раз

Каррагинан увеличивает продолжительность жизни мышей на 20-40% Степень защиты зависит от концентрации каррагинана, времени и способа введения. LD50 ЛПС возрастает в 2-3 раза на фоне каррагинана

13 Новые природные соединения из высших наземных растений

Новые природные соединения из высших наземных растений

Биоорганическая химия

Природные соединения из высших наземных растений Дальнего Востока России изучаются в Институте с момента его основания. В 2006-2010 гг эти работы велись, главным образом, в двух лабораториях Института: в лаборатории химии природных хиноидных соединений (д.х.н. С.А. Федореев) и лаборатории хемотаксономии растений (академик П.Г. Горовой). Широко известны выполненные недавно в Институте исследования биологически активных соединений пигментов нафтохиноидной природы из воробейника краснокорневого, лигнанов и катехинов из тиса остроконечного, изофлавоноидов и производных стильбена из маакии амурской, олигомерных стильбенов из винограда амурского и др.

14 Метаболиты наземных растений

Метаболиты наземных растений

Биоорганическая химия

Полифенолы из стеблей и клеточной культуры Vitis amurensis

Изофлавоноиды культуры клеток M. amurensis

R1=

R5=

6''-o-малонил (6''-o-mal)

O-?-d-глюкопиранозил (o-?-d-glc)

15 Органический синтез природных соединений

Органический синтез природных соединений

Органическая химия

В 2006 -2010 гг. удалось разработать и осуществить следующие синтезы природных соединений: Усовершенствованный синтез эхинохрома А – активной субстанции лекарственных препаратов серии «Гистохром»; Синтез глабрухинонов А и В – биологически активных метаболитов асцидии Aplidium glabrum; Синтез структурных аналогов исландохинона – метоболита лишайника Cetraria islandica; Синтез дибромфаскаплизинов – токсичных для опухолевых клеток соединений из морских губок; Синтез эхинаминов А и В – метаболитов плоских морских ежей; Синтез ломазарина и норломазарина – метаболитов высшего растения Lomandra hastilis; Синтез кристазарина – метаболита лишайника Cladonia cristatella; Синтез аналога арноамина В – цитотоксичного алкалоида из асцидии Cystodytes sp.; Синтез корусканонов А и В - метаболита высшего растения Piper coruscans; Синтез этилиден-3,3‘-бис(2,6,7-тригидрокси-нафтазарина) – метаболита морских ежей родов Spatangus и Strongylocentrotus и ряд других синтезов.

16 Свойства, специфичность, механизм действия, структура и функция

Свойства, специфичность, механизм действия, структура и функция

ферментов морских организмов.

Была установлена методом молекулярного клонирования первичная структура эндо-1,3-?-D-глюканазы из вьетнамской мидии Perna viridis:

Степень идентичности/гомологии эндо-1,3-?-D-глюканаз морских моллюсков (%)

Биохимия и молекулярная биология

Источник 1,3-?-D-глюканаз

M.yessoensis

C.albidus

L.sitkana

S. sachalinensis

P. viridis

Mizuchopecten yessoensis

100

86/93

49/64

45/60

53/68

Chlamys albidus

100

50/63

45/58

53/66

Littorina sitkana

100

54/66

Spisula sachalinenensis

100

43/58

Perna viridis

100

VASWVYAPEPTRGPRRLRGAVMFRDDFNGGGLDTNNWNYEVSMYGGMNWEFQVYTNDKSNVYTNNGKLFLKPTKTVDDPRWDENFLHSGVMDVAQIWGYCTQSAQYGCHREGKNGILPPVMSGKVKSKPVLKYGTVEVRARIPKGDWLWPAIWMLPRDSHYGGWPRSGEIDIMESRGNVRASGHGVNEVSSTLHWGTSAGDNHYGQTTHAKQAADWSNSFHTWRLEWTHDHIATFVDNQQILRVTPPSGGFSELGHTSNIWAGNDKMAPFDKEFYAIFNVAVGGTNGFFPENWDYGYPKPWSNTSPHAAQDWWNGRSKWESSWQGDKVAMEIDYIEMRYL

17 Ферменты морских организмов

Ферменты морских организмов

Установлена первичная структура ДНКазы. Выявлена высокая степень гомологии (67%) аминокислотной последовательности фермента с нуклеазой, выделенной из креветки Penaeus japonicus. Выявлена уникальная способность этого фермента с заметно большей скоростью расщеплять совершенно спаренные дуплексы ДНК в сравнении с несовершенно спаренными дуплексами, имеющими замещение даже одного нуклеотида Установлена первичная структура ?-галактозидазы из морской бактерии Pseudoalteromonas sp. KMM 701, терапевтический потенциал которой заключается в возможности получения с ее помощью «универсальной» донорской крови.

Биохимия и молекулярная биология

18 Молекулярная биология и молекулярная генетика

Молекулярная биология и молекулярная генетика

А Б Дифференциальная диагностика патогенных бактерий рода Yersinia с помощью электрофореза продуктов полимеразной цепной реакции с использованием ДНК, выделенных из различных штаммов псевдотуберкулезного микроба (А), энтероколитики (Б, колонки 1-5) и чумной бактерии (Б, колонки 8-11).

А Б Дифференциальная диагностика патогенных бактерий рода Yersinia с помощью электрофореза продуктов полимеразной цепной реакции с использованием ДНК, выделенных из различных штаммов псевдотуберкулезного микроба (А), энтероколитики (Б, колонки 1-5) и чумной бактерии (Б, колонки 8-11).

1 2 3 4 5 8 9 10 11

19 Изучение молекулярных механизмов действия биологически активных

Изучение молекулярных механизмов действия биологически активных

веществ

Молекулярная биология

Изучен молекулярный механизм противоопухолевого действия некоторых соединений. Установлено, например, что индукция апоптоза фаскаплизинами зависит от каспаз-3, 8 и 9.

Рис. Тотальный (А) и ранний (В) апоптоз, индуцированный 3- и 10-бромофаскаплизинами в HL-60 клетках. Эффекты 3- и 10-бромофаскаплизинов на внутриклеточные уровни проапоптотических белков (С), а также на проницаемость митохондриальной мембраны (D) в HL-60 клетках.

20 Иммуногенные белки грамотрицательных бактерий

Иммуногенные белки грамотрицательных бактерий

Установлена первичная и пространственная структура некоторых иммуногенных белков поринов из бактерий родаYersinia. На основе бактериальных белков-поринов разработаны методы диагностики опасных инфекционных заболеваний – иерсиниозов. Найдены подходы к созданию вакцин для защиты от этих заболеваний.

Молекулярная иммунология

21 Иммуноферментные (ИФА) тест-системы разработаны для диагностики острых

Иммуноферментные (ИФА) тест-системы разработаны для диагностики острых

и вторично-очаговых форм иерсиниозов.

Дифференциальная диагностика иерсиниозов с помощью видоспецифических белков-поринов наружной мембраны бактерий

ПРИЧИНЫ НЕОСЛАБЕВАЮЩЕГО ИНТЕРЕСА К ЗАБОЛЕВАНИЯМ, ВЫЗЫВАЕМЫМ ИЕРСИНИЯМИ Повсеместное распространение и растущая заболеваемость иерсиниозом и псевдотуберкулезом Выраженный полиморфизм клинических проявлений и частое развитие осложнений

1 ряд – контроль; 2 ряд – больные псевдотуберкулезом с бактериологически подтвержденным диагнозом; 3 ряд – больные кишечным иерсиниозом; 4 ряд - больные сальмонеллезом; 5 ряд – больные гепатитом

22 Лектины, выделенные из морских беспозвоночных и водорослей –уникальные

Лектины, выделенные из морских беспозвоночных и водорослей –уникальные

молекулярные инструменты для исследований в области гликобиологии

Гликобиология и молекулярная медицина

Показано, что уровень лектин - реактивных гликоформ в сыворотках крови онкопациентов в 2,5 раза выше, чем в группе доноров. В то время как у больных ИБС не выявлено существенной разницы в уровнях СРБ, определенных ИФА и ТЛФА.

На основе использования лектинов разработаны способы экспресс-диагностики раковых опухолей. Идет их апробация.

Название

Источник

Специфичность

CGL

Мидия Crenomytilus grayanus

Gal/GalNAc

DTL DTL-A

Асцидия Didemnum ternatanum

GlcNAc GlcNAc/GalNAc

SVL-1 SVL-2

Морской червь Serpula vermicularis

Маннаны GlcNAc

TCL

Красная водоросль Tichocarpus crinitus

PSM, Fet

23 Установлена структура О-специфического полисахарида R-формы морской

Установлена структура О-специфического полисахарида R-формы морской

-протеобактерии Pseudoalteromonas agarivorans КММ 332: ?-D-ManpNAcA1 ? 4 ?3)-?-D-FucpNThrAc(1?3)-?-D-GalpNAc-(1?3)-?-L-Rhap(1? Одно из моносахаридных производных в составе полисахарида R-формы P. agarivorans КММ 232 2,6-дидезокси-2-([N-ацетил-L-треонил)-амино-D-фукоза, ранее в природе обнаружено не было

Молекулярная иммунология

О-специфические полисахариды. Разнообразие структур и архитектуры иммуногенных бактериальных полисахаридов

Рис. Электронная микроскопия. Общая морфология клеток штаммов KMM 232 (a, b) и KMM 255T (c–e), показывающая клетки с одним жгутиком и клетки, несущие два или четыре полярных жгутика.

Pseudoalteromonas agarivorans КММ 332

24 Исследования биоресурсов Таксономия морских микроорганизмов

Исследования биоресурсов Таксономия морских микроорганизмов

В ТИБОХ ДВО РАН выполняются впечатляющие работы в области таксономии морских микроорганизмов (чл-корр. РАН В.В. Михайлов). В частности, за период 2006 -2010 гг. в более чем 40 научных статьях были валидно описаны (с применением молекулярно-генетических и современных морфологических методов) более 40 новых видов и 15 новых родов морских бактерий, дана биохимическая характеристика многих из них.

Клетки Formosa agariphila sp. nov. образовывали нити, которые соединяли их друг с другом, и почки на материнских клетках (Рис.) . Это первое сообщение о способности Cytophaga-подобных бактерий к размножению почкованием.

Чл.-корр РАН В.В. Михайлов

25 Исследования биоресурсов

Исследования биоресурсов

«Химические, таксономическое и ресурсоведческое изучение дальневосточных растений – перспективных источников биологически активных веществ»

Ультраструктуры поверхности семянок

Содержание экдистероидов интегристерона A и 20-гидроксиэкдизона в различных частях растений сем. Caryophyllaceae

Эпидерма листьев видов рода Megadenia

Megadenia speluncarum

Megadenia bardunovii

Megadenia pygmaea

Папилла heteropappus saxomarinus

A – верхняя эпидерма, B – нижняя эпидерма

26 Биоиспытания и фармакология

Биоиспытания и фармакология

Противопухолевая активность гинзенозида Rh2 на мышиных моделях карциномы легких Льюиса и меланомы В-16;

В эксперименте на мышах-самках линии С57Bl/6 с карциномой легких Льюис показано, что введение гинзенозида Rh2 в дозе 10 мг/кг привело к достоверному снижению массы первичного опухолевого узла в 1,3 раза по сравнению с контролем. Количество и площадь метастазов в легких мышей достоверно уменьшились относительно контроля в 4,5 и 13,2 раза соответственно, при этом индекс ингибирования метастазирования достигал 83%.

27 Разработан способ выделения полифенольных соединений из морских трав

Разработан способ выделения полифенольных соединений из морских трав

семейства Zosteraceae, позволяющий получать значительные количества розмариновой кислоты, природного антиоксиданта, проявляющего противовирусную и антилейкозную активность, и 7,3'-дисульфата лютеолина, нового биологически активного агента, обладающего канцерпревентивным действием и противовирусной активностью. Методами генетической инженерии получены продуценты ряда ценных рекомбинантных белков, в том числе поринов из бактерий рода Yersinia, которые можно использовать для диагностики иерсиниозов, высокоактивной щелочной фосфатазы из морских бактерий, ряда пептидов с обезболивающим действием из актиний и других.

Биотехнология

28 Разработан и согласован ОПЫТНО-ПРОМЫШЛЕННЫЙ РЕГЛАМЕНТ

Разработан и согласован ОПЫТНО-ПРОМЫШЛЕННЫЙ РЕГЛАМЕНТ

(ОПР-02698170-02-03) на производство препарата "Маакии амурской экстракта сухого".

Разработан и согласован ОПЫТНО-ПРОМЫШЛЕННЫЙ РЕГЛАМЕНТ (ОПР-02698170-02-03) на производство препарата "Маакии амурской экстракта сухого".

Лицензии № 99-04-000243 от 31 октября 2006 г ТИБОХ ДВО РАН на производство, хранение и реализацию препаратов: "Маакии амурской древесина ангро" и "Маакии амурской экстракт сухой"

Лицензии № 99-04-000243 от 31 октября 2006 г ТИБОХ ДВО РАН на производство, хранение и реализацию препаратов: "Маакии амурской древесина ангро" и "Маакии амурской экстракт сухой"

Лицензирование препарата «максар», выпуск его первой опытно-промышленной партии

Инновационная деятельность. Прикладные исследования

Серия к-во упаковок серия к-во упаковок 011207 700 031207 700 021207 700 041207 1500 всего 3600

#

Нормативные документы (НД)

№ Нд

Регистрация препарата МАКСАР

Регистрация препарата МАКСАР

Регистрация препарата МАКСАР

1

Инструкция по медицинскому применению препарата "Максар? в лекарственной форме - таблетки, покрытые оболочкой, 60 мг"

Инструкция по медицинскому применению препарата "Максар? в лекарственной форме - таблетки, покрытые оболочкой, 60 мг"

2

ФСП "Маакии амурской древесина ангро"

Фсп 42-0170-2947-02

3

Регистрационное удостоверение

P №003286/01 от 12.04.2004 г

4

ФСП "Маакии амурской экстракт сухой"

Фсп 42-0170-2948-02

5

Регистрационное удостоверение

P №003309/01 от 12.04.2004 г

6

ФСП "Максар? таблетки, покрытые оболочкой, 60 мг"

Фсп 42-0170-3905-03

7

Регистрационное удостоверение

P №003294/01 от 12.04.2004 г

Лицензирование препарата МАКСАР

Лицензирование препарата МАКСАР

Лицензирование препарата МАКСАР

8

9

Разработан и согласован ПУСКОВОЙ РЕГЛАМЕНТ (ПУР 022698170-01-07) на производство препарата "Максар? таблетки, покрытые оболочкой, 60 мг".

Разработан и согласован ПУСКОВОЙ РЕГЛАМЕНТ (ПУР 022698170-01-07) на производство препарата "Максар? таблетки, покрытые оболочкой, 60 мг".

10

11

Лек. средства, разрешенные к промышленному выпуску и реализации на территории России:1. Маакии амурской древесина ангро 2. Маакии амурской экстракт сухой. 3. Максар? таблетки, покрытые оболочкой, 60 мг

Лек. средства, разрешенные к промышленному выпуску и реализации на территории России:1. Маакии амурской древесина ангро 2. Маакии амурской экстракт сухой. 3. Максар? таблетки, покрытые оболочкой, 60 мг

29 Подана заявка в ФГУ «Научный центр экспертизы средств медицинского

Подана заявка в ФГУ «Научный центр экспертизы средств медицинского

применения» с целью подтверждения государственной регистрации этого лекарственного средства. Получено заключение экспертизы и вновь подготовлено досье на препарат, документы переданы в Минзравсоцразвития на утверждение. Обнаружены новые свойства препарата «Максар®». Показано, что он обладает антитромбогенным и антитромбоцитарным действием. Курсовое введение препарата Максар, как и проведение терапии этинилэстрадиолом, ограничивают процессы перекисного окисления липидов, снижают общее содержание липидов, и нормализуют вязкость крови. Препарат может быть использован в качестве антиклимактерического средства.

Инновационная деятельность.

30 Медицинские препараты, ранее разработанные в ТИБОХ

Медицинские препараты, ранее разработанные в ТИБОХ

Инновационная деятельность.

Перерегистрация медицинских препаратов

Разработан технологический регламент и утверждена ФСП на препарат «Эхинохром, субстанция», RegWorkNx 53606, получено регистрационное удостоверение Р N002362/01 от 20.07.2010. на право выпуска субстанции на двух опытно-технологических участках института. В 2007-2010 г.г. выпущено 3 серии этой субстанции. На основе эхинохрома ранее были разработаны и внедрены в медицинскую практику 2 лекарственных препарата. Выпуск этих препаратов в 2006-2010 гг был продолжен. За отчетный период выпущено 9 серий препаратов (около 100 тыс. упаковок), последняя стадия производства выполнялась на арендованном у ЗАО «Брынцалов А» оборудовании.

В течение 2-х лет успешно выполнена экспертиза итогов клинического применения и документации на медицинские препараты «Гистохром для офтальмологии». «Гистохром для кардиологии» и «Коллагеназа-КК», а также на соответствующие субстанции и исходные материалы. Подготовлены новые досье на эти препараты, они переданы для окончательного заключения в Минздравсоцразвития.

31 Инновационная деятельность

Инновационная деятельность

Многолетние фундаментальные исследования природных соединений

Новые лекарства, пищевые добавки, биопрепараты, функциональные продукты питания

Опытно-экспериментальное производство

Государственный контракт 02.522.11.2013 от 21 июня 2007 г

Медицина, пищевая промышленность, косметика

32 Инновационная деятельность

Инновационная деятельность

СОЗДАНО И РАЗВИВАЕТСЯ ОПЫТНО-ЭКСПЕРИМЕНТАЛЬНОЕ ПРОИЗВОДСТВО Института

Участок экстракции органическими растворителями

Участок органического синтеза

Участок готовых форм

Участок водной экстракции

33 Медицинские препараты, разрабатываемые в ТИБОХ

Медицинские препараты, разрабатываемые в ТИБОХ

Инновационная деятельность.

Кумазид Препарат из съедобной голотурии Кукумария японская. Мощный иммуностимулятор с профилактическим и лечебным действием при иммунодефицитах. Получена опытная партия. Успешно завершены доклинические испытания. Оформляется разрешение на клинические испытания. Максар – новое применение в качестве фитогормонального средства при терапии пост-климактерического синдрома. Оформляется разрешение на клинические испытания. Гистохром синтетический для кардиологии Разработан синтез, получена опытная партия биологически активной субстанции. Начаты доклинические исследования. Коурохитин Разработан синтез активной субстанции и создана композиция с сильным противовоспалительным действием и противоопухолевыми свойствами (совместно с ДВГУ). Получена опытная партия , начаты доклинические испытания. Транслам Иммуномодулирующий и радиопротекторный препарат. Успешно проведены доклинические испытания. Разрабатывается новая генно-инженерная технология Неомититилан. В качестве ранозаживляющего средства существенно превосходит метилурациловую мазь. Получена опытная партия, ведутся доклинические испытания

34 Публикации Института

Публикации Института

Данные Web of Science

Анализ публикационной активности ТИБОХ ДВО РАН в период 2006-2010 г.г. (На рис. приведены данные по публикациям статей в рецензируемых журналах).

Results found:

1,642

Sum of the Times Cited:

9,310

Average Citations per Item:

5.67

h-index :

33

35 Количественные показатели результатов научной деятельности Института

Количественные показатели результатов научной деятельности Института

Виды деятельности

2006

2007

2008

2009

2010

Всего

Общее количество публикаций

301

234

267

228

242

1272

Статьи в рос. рецензируемых журналах

47

67

49

76

100

339

Статьи в межд. рецензируемых журналах

52

44

55

52

51

254

Статьи, всего

99

113

104

128

151

593

Отношение числа статей в рецензируемых журналах к числу научных сотрудников

0,66

0,72

0,76

0,93

1,10

Статьи в базе данных WoS

75

81

71

80

71

378

Отношение числа статей в базе данных WoS к числу научных сотрудников

0,50

0,53

0,52

0,58

0,52

Монографии

4

3

3

1

4

15

Полученные патенты

7

4

9

15

10

45

Защищенные диссертации (д.н. / к.н.)

1 / 3

1 / 5

1 / 4

1 / 7

2 / 2

6 / 21

Присвоенные звания профессора/доцента

0 / 1

0 / 0

1 / 0

2 / 0

0 / 3

3 / 4

Удельный вес договорных работ (в % от общего объема финансирования)*

17,8

34,7

29,8

24,6

11,1

27,4

- *В данный раздел включены хоздоговоры, ГК, гранты РФФИ, гранты Президента РФ.

36 Анализ цитируемости публикаций Института

Анализ цитируемости публикаций Института

Цитирование

Цитирование

Годы

Годы

Годы

Годы

Годы

Годы

Годы

Годы

1980 – 2001

2005

2006

2007

2008

2009

2010

2011

Общее

9201

630

654

661

790

869

823

260

На научного сотрудника

67,17

4,17

4,36

4,82

5,76

6,34

6,00

1,8

Анализ данных по цитированию последних публикаций Института

Анализ данных по цитированию последних публикаций Института

Анализ данных по цитированию последних публикаций Института

Анализ данных по цитированию последних публикаций Института

Анализ данных по цитированию последних публикаций Института

Анализ данных по цитированию последних публикаций Института

Анализ данных по цитированию последних публикаций Института

Анализ данных по цитированию последних публикаций Института

Анализ данных по цитированию последних публикаций Института

2005

2006

2007

2008

2009

2010

Всего

Кол-во статей в базе WoS

Кол-во статей в базе WoS

79

75

81

71

80

71

457

Кол-во цитирований

Кол-во цитирований

505

314

218

202

79

4

1322

Кол-во цитирований на одну публикацию

Кол-во цитирований на одну публикацию

6,39

4,19

2,73

2,45

0,98

0,05

Кол-во цитирований на научного сотрудн.

Кол-во цитирований на научного сотрудн.

3,37

2,08

1,42

1,47

0,58

37 Цитируемость некоторых научных сотрудников

Цитируемость некоторых научных сотрудников

Фамилия и научная степень автора

Количество публикаций в базе WoS

Общая цитируемость

Цитируемость публикаций 2005-2010 г.г.

академик Стоник В. А.

282

2083

294

чл.-корр. РАН Михайлов В. В.

143

1654

346

д.х.н. Калиновский А. И.

189

1220

186

д.б.н. Иванова Е. П.

100

1233

137

д.б.н. Недашковская О. И.

78

773

298

д.х.н. Соловьева Т.Ф.

120

598

51

д.х.н. Макарьева Т. Н.

76

577

61

д.х.н. Калинин В. И.

51

574

86

к.х.н. Денисенко В. А

127

559

113

к.б.н. Фролова Г. М.

52

554

177

к.х.н. Дмитренок П. С.

114

539

237

д.х.н. Звягинцева Т. Н.

84

538

140

д.б.н. Романенко Л. А.

54

511

103

38 Место публикаций Института в рейтинге публикаций институтов ДВО РАН

Место публикаций Института в рейтинге публикаций институтов ДВО РАН

Число статей в изданиях, индексируемых базой WoS, за 2006-2010 гг. в сравнении с 2010 г., на 1 н. с. Институты ранжированы по среднему за 5 лет показателю.

Доля статей в рецензируемых изданиях в общем количестве публикаций 2010 г. (без учета книг, патентов и т.п.). Прямые линии – среднее значение по ДВО: верхняя – доля публикаций в рецензируемых изданиях, нижняя – индексируемых в международных базах данных (Web of Science и Scopus).

39 Некоторые публикации в научных журналах высокого уровня: Ligand of

Некоторые публикации в научных журналах высокого уровня: Ligand of

scavenger receptor –class A indirectly induces maturation of human blood dendritic cells via production of tumor necrosis factor-alpha by Jin et al. Blood, 2009, 113,23,5539 Impact factor 10,55 Genome analysis of the proteorhodopsin-containing marine bacterium Polaribacter sp. MED 152 (Flavobacteria) by Gonzales et al. Proc. Natl. Acad. USA, 2008, 805,123, 8724, Impact factor 9,43 Resonant electron capture by some aminoacids and their methyl esters by Voinov VG et al. J. Am. Chem. Soc. 2006, 128, 18, 5506, Impact factor 8,58 Analgetic compounds from sea anemone Heteractis crispa is the first polypeptide inhibitor of vanilloid receptor (TRPVI) by Andreev VA et al. Journal of Biological Chemistry, 2008, 283, 35, 23414, Impact factor 7,385 Monanchacidin, a new polyclic guanidine alkaloid from the marine sponge Monanchora pulchra by Guzii AG et al. Organic Letters, 2010, 12, 19, 4292. Impact factor 5,42 Dactylone inhibits epidermal growth factor-induced transformation and phenotype expression of human cancer cells and induces G1-S arrest and apoptosis by Fedorov SN et al. Cancer research 2007;67(12):5914-20 Impact factor 5,33

40 Научные и государственные награды

Научные и государственные награды

В отчетный период лауреатами премии ДВО РАН имени выдающихся ученых Дальнего Востока России (биоорганическая химия – премия им. академика Г.Б. Елякова) стали следующие сотрудники Института: 2007 г. – к.х.н. А.С. Сильченко (молодежный конкурс – до 35 лет); 2008 г. – к.х.н. Т.А. Кузнецова; 2009 г. – к.х.н. Е.Г. Ляхова и С.А. Колесникова (молодежный конкурс); 2010 г. – д.х.н. Т.Н. Макарьева. К.б.н. Рассказов В.А. был награжден медалью ордена «За заслуги перед отечеством» II степени за вклад в развитие отечественной науки и многолетнюю плодотворную деятельность; вед. инженер Логунов Александр Васильевич награжден нагрудным знаком «За содействие МВД России» (2010 г.) Ряд сотрудников получили Почетные грамоты, премии и награды (медали) от Краевой администрации, Думы Приморского края, мэрии Владивостока. Акад. В.А. Стоник избран почетным доктором (Doctor causa) Вьетнамской академии наук и технологий (2010 г.).

41 Правовая защита объектов интеллектуальной собственности

Правовая защита объектов интеллектуальной собственности

По состоянию на 31.12. 2010 г. действует 80 патентов РФ на изобретения, 10 зарубежных патентов, 11 свидетельств на товарные знаки. За отчетный период 36 патентов РФ на изобретения и 2 зарубежных патента прекратили действие по причине истечения срока действия, либо коммерческой нецелесообразности дальнейшего их поддержания в силе.

Юридические действия / годы

2006

2007

2008

2009

2010

Всего

Количество заявок на изобретения

11

12

10

16

14

63

Количество патентов на изобретения

7

4

9

15

10

45

Количество заявок на товарные знаки

-

-

-

-

-

-

Количество полученных свидетельств на товарные знаки

1

-

-

-

1

Количество патентов на изобретения, прекративших действие

1

4

8

21

2

36

Количество действующих зарубежных патентов

7

11

11

12

10

42 Научно-экспериментальная база

Научно-экспериментальная база

Спектрометр ЯМР, Bruker, Avance-III, 700, введен в эксплуатацию 31.05.2009 г.

Времяпролетный МАЛДИ-ТОФ-ТОФ масс-спектрометр ULTRAFLEX-III (2009г.) ДНК – секвенатор «ABI Prism 3130Х Genetic Analyzer» («Applied Biosys-tems», США) введен в эксплуатацию 19 мая 2010 г;

Хроматограф милихром а-02

БЭТА-СЧЕТЧИК TRI-CARB (2007г.)

Проточный цитофлюориметр FACSCalibur

Секвенатор белков Procise 492 cLC

43 Показатели работы аспирантуры

Показатели работы аспирантуры

Показатели работы аспирантуры

2006

2007

2008

2009

2010

Прием аспирантов, чел.

1

6

5

12

6

Количество аспирантов на конец отчетного года

15

11

10

22

21

Выпуск из аспирантуры

2

8

2

3

6

Выпускники аспирантуры, зачисленные в штат Института

2

7

2

3

6

Защищено в диссертационном совете кандидатских диссертаций (всего/аспирантами и соискателями Института)

3/2

5/1

4/4

7/1

2/1

Основной поставщик молодых кадров – Отделение биоорганической химии и биотехнологии ДВФУ

44 Международная деятельность

Международная деятельность

Мероприятие

2006

2007

2008

2009

2010

Участие Института в долгосрочных международных программах

1

2

2

2

1

Международное сотрудничество в рамках двусторонних соглашений

6

8

8

4

6

Количество проведенных на базе Института международных мероприятий

-

1

1

-

-

Участие Института в международных мероприятиях, проведенных другими организациями в России.

19

31

20

10

11

Число загранкомандировок

13

14

12

13

8

Принято зарубежных ученых

18

31

20

17

40

Совместные морские экспедиции

-

1

-

-

1

Стажировки ученых за рубежом

-

-

-

2

2

Стажировки иностранных ученых в Институте

-

-

4

3

2

Участие ученых в зарубежных конференциях

12

12

8

7

13

Количество выполняемых работ по международным грантам

1

1

1

1

45 Совместные научные исследования с зарубежными партнерами

Совместные научные исследования с зарубежными партнерами

Необходимо отметить результаты, полученные в рамках следующих соглашений: 1. Университет штата Миннесота, Институт Хормел (Остин, США, 2001 г.). Опубликованы пять статей. 2. Институт химии биологически активных веществ Национального центра исследовани (Неаполь, Италия, 2003 г.). Совместные исследования природных морских соединений. Опубликованы четыре статьи. 3. Орегонский государственный университет (США). Установление структуры морских природных продуктов с помощью масс-спектрометрии. Рег. № 265 от 29.06.2005 г. Опубликованы восемь статей, оформлен совместный патент. 4. Медицинский Исследовательский центр молекулярной терапии рака Донг-A университета (Пусан, Южная Корея). Поиск и всесторонние исследования противоопухолевых препаратов. Рег. № 492 от 14.11.2005 г. Получено два патента. Опубликованы восемь статей. 5. Чусун Университет, Колледж фармакологии, лаборатория биохимии (Гуанг Джу, Южная Корея). Исследованию фукоиданов и ламинаранов: Рег. № 357 от 14.12.2006 г. Опубликованы две статьи. 6. Институт химии природных продуктов ВАНТ (Ханой, СРВ). Совместные комплексные исследования морских природных соединений из морских биологических объектов, обитающих во Вьетнамских и Дальневосточных морях: Рег. № 507 от 29.12.2008 г. Опубликованы пять статей.

46 Экспедиции

Экспедиции

2007 г Российско-Вьетнамская экспедиция на борту НИС «Академик Опарин» (рейс № 34) организована ТИБОХ, ИБМ и ИАПУ ДВО РАН совместно с Институтом Океанографии (ИО) Вьетнамской академии науки и технологии (ВАНТ) Основная цель: всестороннее исследование коралловых рифовых сообществ шельфа Вьетнама (провинция Кнань Хоа) и нескольких районов в Южно-Китайском море, включая сбор и идентификацию макро- и микроорганизмов для поиска новых источников биологически активных метаболитов. В работе экспедиции принимали участие 31 представитель институтов ДВО РАН и 5 научных сотрудников ИО ВАНТ. 2010 г. ТИБОХ и ИБМ ДВО РАН при содействии Вьетнамской академии науки и технологии организовали и провели совместный Российско-Вьетнамский экспедиционный рейс № 38 на борту НИС «Академик Опарин» в территориальные воды Социалистической республики Вьетнам. Впервые Вьетнамская сторона внесла свой вклад в финансирование экспедиции. Продолжительность рейса составила 55 суток. В работе экспедиции приняли участие 29 представителей институтов ДВО РАН и 10 научных сотрудников из четырех институтов ВАНТ во главе с руководителем группы к.б.н. Тринь Тхэ Хью. По окончании рейса в Институте химии природных продуктов ВАНТ (Ханой) была проведена Международная Конференция по морским биологическим ресурсам Вьетнама «Российско-Вьетнамская экспедиция: Морские биологически активные соединения и биоразнообразие Вьетнама».

47 Благодарю за внимание

Благодарю за внимание

«Основные результаты научной и научно-организационной деятельности Учреждения Российской академии наук Тихоокеанского института биоорганической химии Дальневосточного отделения РАН за период 2006 - 2010 гг»
http://900igr.net/prezentacija/pedagogika/osnovnye-rezultaty-nauchnoj-i-nauchno-organizatsionnoj-dejatelnosti-uchrezhdenija-rossijskoj-akademii-nauk-tikhookeanskogo-instituta-bioorganicheskoj-khimii-dalnevostochnogo-otdelenija-ran-za-period-2006-2010-gg-146140.html
cсылка на страницу
Урок

Педагогика

135 тем
Слайды
900igr.net > Презентации по педагогике > Научное исследование > Основные результаты научной и научно-организационной деятельности Учреждения Российской академии наук Тихоокеанского института биоорганической химии Дальневосточного отделения РАН за период 2006 - 2010 гг